Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 13927..14570 Replicon plasmid unnamed2
Accession NZ_CP124816
Organism Citrobacter freundii strain CF12

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag QLG15_RS25230 Protein ID WP_000754566.1
Coordinates 14154..14570 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag QLG15_RS25225 Protein ID WP_001261276.1
Coordinates 13927..14157 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG15_RS25190 (QLG15_25200) 9046..9315 + 270 WP_000339857.1 hypothetical protein -
QLG15_RS25195 (QLG15_25205) 9492..10358 - 867 WP_004118283.1 replication initiation protein -
QLG15_RS25200 (QLG15_25210) 10888..10992 + 105 WP_032409716.1 hypothetical protein -
QLG15_RS25205 (QLG15_25215) 11121..11378 + 258 WP_000764642.1 hypothetical protein -
QLG15_RS25210 (QLG15_25220) 11436..12212 - 777 WP_000015958.1 site-specific integrase -
QLG15_RS25215 (QLG15_25225) 12209..12952 - 744 WP_000129823.1 hypothetical protein -
QLG15_RS25220 (QLG15_25230) 13003..13353 - 351 WP_000493378.1 hypothetical protein -
QLG15_RS25225 (QLG15_25235) 13927..14157 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QLG15_RS25230 (QLG15_25240) 14154..14570 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
QLG15_RS25235 (QLG15_25245) 14774..15582 + 809 Protein_17 IS3-like element ISEc15 family transposase -
QLG15_RS25240 (QLG15_25250) 15688..16524 - 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
QLG15_RS25245 (QLG15_25255) 16524..17327 - 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
QLG15_RS25255 (QLG15_25265) 18628..19242 - 615 WP_000904906.1 recombinase family protein -
QLG15_RS25260 (QLG15_25270) 19368..19493 + 126 WP_012512729.1 DUF4158 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(6)-Id / aph(3'')-Ib / tet(B) / blaTEM-1B - 1..41037 41037


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T281267 WP_000754566.1 NZ_CP124816:14154-14570 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT281267 WP_001261276.1 NZ_CP124816:13927-14157 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References