Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4098521..4099175 | Replicon | chromosome |
| Accession | NZ_CP124813 | ||
| Organism | Citrobacter freundii strain CF12 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | QLG15_RS19920 | Protein ID | WP_003026936.1 |
| Coordinates | 4098521..4098928 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | QLG15_RS19925 | Protein ID | WP_003026938.1 |
| Coordinates | 4098909..4099175 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG15_RS19900 (4094469) | 4094469..4096202 | - | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QLG15_RS19905 (4096208) | 4096208..4096921 | - | 714 | WP_003026923.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QLG15_RS19910 (4096945) | 4096945..4097841 | - | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
| QLG15_RS19915 (4097955) | 4097955..4098476 | + | 522 | WP_003026933.1 | flavodoxin FldB | - |
| QLG15_RS19920 (4098521) | 4098521..4098928 | - | 408 | WP_003026936.1 | protein YgfX | Toxin |
| QLG15_RS19925 (4098909) | 4098909..4099175 | - | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| QLG15_RS19930 (4099432) | 4099432..4100412 | + | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
| QLG15_RS19935 (4100506) | 4100506..4101165 | - | 660 | WP_003838267.1 | hemolysin III family protein | - |
| QLG15_RS19940 (4101328) | 4101328..4101639 | - | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
| QLG15_RS19945 (4101692) | 4101692..4102420 | + | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| QLG15_RS19950 (4102541) | 4102541..4103974 | + | 1434 | WP_044700805.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T281264 WP_003026936.1 NZ_CP124813:c4098928-4098521 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |