Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4049687..4050348 | Replicon | chromosome |
| Accession | NZ_CP124813 | ||
| Organism | Citrobacter freundii strain CF12 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | S3IMJ6 |
| Locus tag | QLG15_RS19620 | Protein ID | WP_000698542.1 |
| Coordinates | 4049687..4050010 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | QLG15_RS19625 | Protein ID | WP_167736232.1 |
| Coordinates | 4050031..4050348 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG15_RS19595 (4045029) | 4045029..4045607 | + | 579 | WP_044700788.1 | tyrosine-type recombinase/integrase | - |
| QLG15_RS19600 (4045701) | 4045701..4045898 | + | 198 | WP_044700790.1 | hypothetical protein | - |
| QLG15_RS19605 (4045880) | 4045880..4046188 | + | 309 | WP_170864030.1 | hypothetical protein | - |
| QLG15_RS19610 (4046596) | 4046596..4047093 | - | 498 | WP_044700793.1 | hypothetical protein | - |
| QLG15_RS19615 (4047417) | 4047417..4048585 | + | 1169 | WP_100216202.1 | IS3 family transposase | - |
| QLG15_RS19620 (4049687) | 4049687..4050010 | - | 324 | WP_000698542.1 | TA system toxin CbtA family protein | Toxin |
| QLG15_RS19625 (4050031) | 4050031..4050348 | - | 318 | WP_167736232.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QLG15_RS19630 (4050367) | 4050367..4050588 | - | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
| QLG15_RS19635 (4050597) | 4050597..4051073 | - | 477 | WP_000811694.1 | RadC family protein | - |
| QLG15_RS19640 (4051089) | 4051089..4051547 | - | 459 | WP_016538084.1 | antirestriction protein | - |
| QLG15_RS19645 (4051633) | 4051633..4051869 | - | 237 | WP_000004273.1 | DUF905 domain-containing protein | - |
| QLG15_RS19650 (4051947) | 4051947..4052357 | - | 411 | WP_000912997.1 | hypothetical protein | - |
| QLG15_RS19655 (4052424) | 4052424..4052861 | - | 438 | WP_024198335.1 | hypothetical protein | - |
| QLG15_RS19660 (4052903) | 4052903..4053439 | - | 537 | WP_000219797.1 | DUF4339 domain-containing protein | - |
| QLG15_RS19665 (4053465) | 4053465..4054175 | - | 711 | WP_024198336.1 | hypothetical protein | - |
| QLG15_RS19670 (4054384) | 4054384..4055208 | - | 825 | WP_000197385.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4041065..4089877 | 48812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.38 Da Isoelectric Point: 8.9789
>T281263 WP_000698542.1 NZ_CP124813:c4050010-4049687 [Citrobacter freundii]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|