Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1220760..1221380 | Replicon | chromosome |
Accession | NZ_CP124813 | ||
Organism | Citrobacter freundii strain CF12 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QLG15_RS05830 | Protein ID | WP_002892050.1 |
Coordinates | 1220760..1220978 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | QLG15_RS05835 | Protein ID | WP_003021733.1 |
Coordinates | 1221006..1221380 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG15_RS05795 (1215993) | 1215993..1216622 | + | 630 | WP_003835929.1 | membrane protein | - |
QLG15_RS05800 (1216687) | 1216687..1217040 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
QLG15_RS05805 (1217092) | 1217092..1218645 | - | 1554 | WP_044699371.1 | EAL domain-containing protein | - |
QLG15_RS05810 (1218834) | 1218834..1219094 | + | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
QLG15_RS05815 (1219096) | 1219096..1219236 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
QLG15_RS05820 (1219315) | 1219315..1219785 | - | 471 | WP_003021724.1 | YlaC family protein | - |
QLG15_RS05825 (1219902) | 1219902..1220453 | - | 552 | WP_044699372.1 | maltose O-acetyltransferase | - |
QLG15_RS05830 (1220760) | 1220760..1220978 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QLG15_RS05835 (1221006) | 1221006..1221380 | - | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
QLG15_RS05840 (1221868) | 1221868..1225017 | - | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
QLG15_RS05845 (1225040) | 1225040..1226233 | - | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281258 WP_002892050.1 NZ_CP124813:c1220978-1220760 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT281258 WP_003021733.1 NZ_CP124813:c1221380-1221006 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |