Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 13957..14600 Replicon plasmid unnamed1
Accession NZ_CP124811
Organism Citrobacter freundii strain CF13

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag QLG16_RS25050 Protein ID WP_000754566.1
Coordinates 14184..14600 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag QLG16_RS25045 Protein ID WP_001261276.1
Coordinates 13957..14187 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG16_RS25010 (QLG16_25010) 9076..9345 + 270 WP_000339857.1 hypothetical protein -
QLG16_RS25015 (QLG16_25015) 9522..10388 - 867 WP_004118283.1 replication initiation protein -
QLG16_RS25020 (QLG16_25020) 10918..11022 + 105 WP_032409716.1 hypothetical protein -
QLG16_RS25025 (QLG16_25025) 11151..11408 + 258 WP_000764642.1 hypothetical protein -
QLG16_RS25030 (QLG16_25030) 11466..12242 - 777 WP_000015958.1 site-specific integrase -
QLG16_RS25035 (QLG16_25035) 12239..12982 - 744 WP_000129823.1 hypothetical protein -
QLG16_RS25040 (QLG16_25040) 13033..13383 - 351 WP_000493378.1 hypothetical protein -
QLG16_RS25045 (QLG16_25045) 13957..14187 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QLG16_RS25050 (QLG16_25050) 14184..14600 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
QLG16_RS25055 (QLG16_25055) 14804..15612 + 809 Protein_17 IS3-like element ISEc15 family transposase -
QLG16_RS25060 (QLG16_25060) 15718..16554 - 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
QLG16_RS25065 (QLG16_25065) 16554..17357 - 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
QLG16_RS25075 (QLG16_25075) 18658..19272 - 615 WP_000904906.1 recombinase family protein -
QLG16_RS25080 (QLG16_25080) 19398..19523 + 126 WP_012512729.1 DUF4158 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(6)-Id / aph(3'')-Ib / tet(B) / blaTEM-1B - 1..41037 41037


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T281253 WP_000754566.1 NZ_CP124811:14184-14600 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT281253 WP_001261276.1 NZ_CP124811:13957-14187 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References