Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4084026..4084687 | Replicon | chromosome |
Accession | NZ_CP124809 | ||
Organism | Citrobacter freundii strain CF13 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | S3IMJ6 |
Locus tag | QLG16_RS19735 | Protein ID | WP_000698542.1 |
Coordinates | 4084026..4084349 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QLG16_RS19740 | Protein ID | WP_167736232.1 |
Coordinates | 4084370..4084687 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG16_RS19710 (4079368) | 4079368..4079946 | + | 579 | WP_044700788.1 | tyrosine-type recombinase/integrase | - |
QLG16_RS19715 (4080040) | 4080040..4080237 | + | 198 | WP_044700790.1 | hypothetical protein | - |
QLG16_RS19720 (4080219) | 4080219..4080527 | + | 309 | WP_170864030.1 | hypothetical protein | - |
QLG16_RS19725 (4080935) | 4080935..4081432 | - | 498 | WP_044700793.1 | hypothetical protein | - |
QLG16_RS19730 (4081756) | 4081756..4082924 | + | 1169 | WP_100216202.1 | IS3 family transposase | - |
QLG16_RS19735 (4084026) | 4084026..4084349 | - | 324 | WP_000698542.1 | TA system toxin CbtA family protein | Toxin |
QLG16_RS19740 (4084370) | 4084370..4084687 | - | 318 | WP_167736232.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QLG16_RS19745 (4084706) | 4084706..4084927 | - | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
QLG16_RS19750 (4084936) | 4084936..4085412 | - | 477 | WP_000811694.1 | RadC family protein | - |
QLG16_RS19755 (4085428) | 4085428..4085886 | - | 459 | WP_016538084.1 | antirestriction protein | - |
QLG16_RS19760 (4085972) | 4085972..4086208 | - | 237 | WP_000004273.1 | DUF905 domain-containing protein | - |
QLG16_RS19765 (4086286) | 4086286..4086696 | - | 411 | WP_000912997.1 | hypothetical protein | - |
QLG16_RS19770 (4086763) | 4086763..4087200 | - | 438 | WP_024198335.1 | hypothetical protein | - |
QLG16_RS19775 (4087242) | 4087242..4087778 | - | 537 | WP_000219797.1 | DUF4339 domain-containing protein | - |
QLG16_RS19780 (4087804) | 4087804..4088514 | - | 711 | WP_024198336.1 | hypothetical protein | - |
QLG16_RS19785 (4088723) | 4088723..4089547 | - | 825 | WP_000197385.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4075404..4124216 | 48812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.38 Da Isoelectric Point: 8.9789
>T281249 WP_000698542.1 NZ_CP124809:c4084349-4084026 [Citrobacter freundii]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|