Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1221536..1222156 | Replicon | chromosome |
| Accession | NZ_CP124809 | ||
| Organism | Citrobacter freundii strain CF13 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QLG16_RS05845 | Protein ID | WP_002892050.1 |
| Coordinates | 1221536..1221754 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | QLG16_RS05850 | Protein ID | WP_003021733.1 |
| Coordinates | 1221782..1222156 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG16_RS05810 (1216769) | 1216769..1217398 | + | 630 | WP_003835929.1 | membrane protein | - |
| QLG16_RS05815 (1217463) | 1217463..1217816 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
| QLG16_RS05820 (1217868) | 1217868..1219421 | - | 1554 | WP_044699371.1 | EAL domain-containing protein | - |
| QLG16_RS05825 (1219610) | 1219610..1219870 | + | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
| QLG16_RS05830 (1219872) | 1219872..1220012 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| QLG16_RS05835 (1220091) | 1220091..1220561 | - | 471 | WP_003021724.1 | YlaC family protein | - |
| QLG16_RS05840 (1220678) | 1220678..1221229 | - | 552 | WP_044699372.1 | maltose O-acetyltransferase | - |
| QLG16_RS05845 (1221536) | 1221536..1221754 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QLG16_RS05850 (1221782) | 1221782..1222156 | - | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| QLG16_RS05855 (1222644) | 1222644..1225793 | - | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| QLG16_RS05860 (1225816) | 1225816..1227009 | - | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281244 WP_002892050.1 NZ_CP124809:c1221754-1221536 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT281244 WP_003021733.1 NZ_CP124809:c1222156-1221782 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |