Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 567827..568343 | Replicon | chromosome |
Accession | NZ_CP124809 | ||
Organism | Citrobacter freundii strain CF13 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QLG16_RS02880 | Protein ID | WP_044699148.1 |
Coordinates | 568059..568343 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | QLG16_RS02875 | Protein ID | WP_003839576.1 |
Coordinates | 567827..568069 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG16_RS02855 (562842) | 562842..563975 | + | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
QLG16_RS02860 (563959) | 563959..565077 | + | 1119 | WP_044699152.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
QLG16_RS02865 (565074) | 565074..565814 | + | 741 | WP_044699149.1 | KDGP aldolase family protein | - |
QLG16_RS02870 (565836) | 565836..567749 | + | 1914 | WP_003839574.1 | BglG family transcription antiterminator | - |
QLG16_RS02875 (567827) | 567827..568069 | + | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QLG16_RS02880 (568059) | 568059..568343 | + | 285 | WP_044699148.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLG16_RS02885 (568347) | 568347..568811 | - | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QLG16_RS02890 (568918) | 568918..571056 | - | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QLG16_RS02895 (571434) | 571434..572018 | - | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10865.69 Da Isoelectric Point: 10.1988
>T281243 WP_044699148.1 NZ_CP124809:568059-568343 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|