Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 26525..27168 Replicon plasmid unnamed2
Accession NZ_CP124806
Organism Klebsiella variicola strain J57

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag QLG20_RS28240 Protein ID WP_001044770.1
Coordinates 26525..26941 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QLG20_RS28245 Protein ID WP_001261282.1
Coordinates 26938..27168 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG20_RS28200 (QLG20_28190) 21895..22182 - 288 WP_009486461.1 thermonuclease family protein -
QLG20_RS28205 (QLG20_28195) 22236..22367 - 132 Protein_27 DNA polymerase V subunit UmuC -
QLG20_RS28210 (QLG20_28200) 22475..22911 + 437 Protein_28 transposase -
QLG20_RS28215 (QLG20_28205) 23101..23475 + 375 WP_001348195.1 cupin domain-containing protein -
QLG20_RS28220 (QLG20_28210) 23499..24062 + 564 WP_001097412.1 chlorite dismutase family protein -
QLG20_RS28225 (QLG20_28215) 24313..25410 - 1098 Protein_31 IS66 family transposase -
QLG20_RS28230 (QLG20_28220) 25464..26168 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
QLG20_RS28235 (QLG20_28225) 26233..26451 - 219 Protein_33 ATP-binding protein -
QLG20_RS28240 (QLG20_28230) 26525..26941 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
QLG20_RS28245 (QLG20_28235) 26938..27168 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QLG20_RS28250 (QLG20_28240) 27152..27406 + 255 Protein_36 hypothetical protein -
QLG20_RS28255 (QLG20_28245) 27732..28019 + 288 WP_023307514.1 hypothetical protein -
QLG20_RS28260 (QLG20_28250) 28098..28865 + 768 WP_227666617.1 hypothetical protein -
QLG20_RS28265 (QLG20_28255) 28916..29692 + 777 WP_032423393.1 site-specific integrase -
QLG20_RS28270 (QLG20_28260) 29838..30773 - 936 WP_282676421.1 Rpn family recombination-promoting nuclease/putative transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..97591 97591


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T281239 WP_001044770.1 NZ_CP124806:c26941-26525 [Klebsiella variicola]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT281239 WP_001261282.1 NZ_CP124806:c27168-26938 [Klebsiella variicola]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References