Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 26525..27168 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP124806 | ||
| Organism | Klebsiella variicola strain J57 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | QLG20_RS28240 | Protein ID | WP_001044770.1 |
| Coordinates | 26525..26941 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | QLG20_RS28245 | Protein ID | WP_001261282.1 |
| Coordinates | 26938..27168 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG20_RS28200 (QLG20_28190) | 21895..22182 | - | 288 | WP_009486461.1 | thermonuclease family protein | - |
| QLG20_RS28205 (QLG20_28195) | 22236..22367 | - | 132 | Protein_27 | DNA polymerase V subunit UmuC | - |
| QLG20_RS28210 (QLG20_28200) | 22475..22911 | + | 437 | Protein_28 | transposase | - |
| QLG20_RS28215 (QLG20_28205) | 23101..23475 | + | 375 | WP_001348195.1 | cupin domain-containing protein | - |
| QLG20_RS28220 (QLG20_28210) | 23499..24062 | + | 564 | WP_001097412.1 | chlorite dismutase family protein | - |
| QLG20_RS28225 (QLG20_28215) | 24313..25410 | - | 1098 | Protein_31 | IS66 family transposase | - |
| QLG20_RS28230 (QLG20_28220) | 25464..26168 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| QLG20_RS28235 (QLG20_28225) | 26233..26451 | - | 219 | Protein_33 | ATP-binding protein | - |
| QLG20_RS28240 (QLG20_28230) | 26525..26941 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QLG20_RS28245 (QLG20_28235) | 26938..27168 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QLG20_RS28250 (QLG20_28240) | 27152..27406 | + | 255 | Protein_36 | hypothetical protein | - |
| QLG20_RS28255 (QLG20_28245) | 27732..28019 | + | 288 | WP_023307514.1 | hypothetical protein | - |
| QLG20_RS28260 (QLG20_28250) | 28098..28865 | + | 768 | WP_227666617.1 | hypothetical protein | - |
| QLG20_RS28265 (QLG20_28255) | 28916..29692 | + | 777 | WP_032423393.1 | site-specific integrase | - |
| QLG20_RS28270 (QLG20_28260) | 29838..30773 | - | 936 | WP_282676421.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..97591 | 97591 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T281239 WP_001044770.1 NZ_CP124806:c26941-26525 [Klebsiella variicola]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |