Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 89714..90450 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP124805 | ||
| Organism | Klebsiella variicola strain J57 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | QLG20_RS27615 | Protein ID | WP_003026803.1 |
| Coordinates | 89968..90450 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | QLG20_RS27610 | Protein ID | WP_003026799.1 |
| Coordinates | 89714..89980 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG20_RS27575 (QLG20_27565) | 85558..85920 | - | 363 | WP_004206665.1 | arsenite efflux transporter metallochaperone ArsD | - |
| QLG20_RS27580 (QLG20_27570) | 85972..86322 | - | 351 | WP_004206664.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| QLG20_RS27585 (QLG20_27575) | 86680..86928 | + | 249 | WP_004193994.1 | hypothetical protein | - |
| QLG20_RS27590 (QLG20_27580) | 86925..88136 | + | 1212 | WP_032415728.1 | hypothetical protein | - |
| QLG20_RS27595 (QLG20_27585) | 88270..88761 | + | 492 | WP_004206662.1 | hypothetical protein | - |
| QLG20_RS27600 (QLG20_27590) | 88822..89025 | + | 204 | WP_004206661.1 | HHA domain-containing protein | - |
| QLG20_RS27605 (QLG20_27595) | 89039..89269 | + | 231 | WP_004206660.1 | hypothetical protein | - |
| QLG20_RS27610 (QLG20_27600) | 89714..89980 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| QLG20_RS27615 (QLG20_27605) | 89968..90450 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| QLG20_RS27620 (QLG20_27610) | 90651..92054 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| QLG20_RS27625 (QLG20_27615) | 92083..92715 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| QLG20_RS27630 (QLG20_27620) | 92941..94287 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| QLG20_RS27635 (QLG20_27625) | 94336..94731 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..174299 | 174299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T281238 WP_003026803.1 NZ_CP124805:89968-90450 [Klebsiella variicola]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |