Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5501175..5501800 | Replicon | chromosome |
Accession | NZ_CP124804 | ||
Organism | Klebsiella variicola strain J57 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1F2M041 |
Locus tag | QLG20_RS26745 | Protein ID | WP_008807903.1 |
Coordinates | 5501175..5501558 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | QLG20_RS26750 | Protein ID | WP_004150355.1 |
Coordinates | 5501558..5501800 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG20_RS26730 (QLG20_26720) | 5498541..5499443 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
QLG20_RS26735 (QLG20_26725) | 5499440..5500075 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
QLG20_RS26740 (QLG20_26730) | 5500072..5501001 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
QLG20_RS26745 (QLG20_26735) | 5501175..5501558 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QLG20_RS26750 (QLG20_26740) | 5501558..5501800 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
QLG20_RS26755 (QLG20_26745) | 5502005..5502922 | + | 918 | WP_064180736.1 | alpha/beta hydrolase | - |
QLG20_RS26760 (QLG20_26750) | 5502937..5503878 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
QLG20_RS26765 (QLG20_26755) | 5503923..5504360 | - | 438 | WP_008807906.1 | D-aminoacyl-tRNA deacylase | - |
QLG20_RS26770 (QLG20_26760) | 5504357..5505217 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
QLG20_RS26775 (QLG20_26765) | 5505211..5505810 | - | 600 | WP_008807908.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T281236 WP_008807903.1 NZ_CP124804:c5501558-5501175 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M041 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |