Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4845234..4845810 | Replicon | chromosome |
Accession | NZ_CP124804 | ||
Organism | Klebsiella variicola strain J57 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | QLG20_RS23620 | Protein ID | WP_012542979.1 |
Coordinates | 4845523..4845810 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | QLG20_RS23615 | Protein ID | WP_022065028.1 |
Coordinates | 4845234..4845536 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG20_RS23590 (QLG20_23580) | 4840643..4841707 | - | 1065 | WP_008807596.1 | DUF2955 domain-containing protein | - |
QLG20_RS23595 (QLG20_23585) | 4841697..4842764 | - | 1068 | WP_039102796.1 | HlyD family secretion protein | - |
QLG20_RS23600 (QLG20_23590) | 4842771..4843235 | - | 465 | WP_008807598.1 | MarR family transcriptional regulator | - |
QLG20_RS23605 (QLG20_23595) | 4843401..4843565 | - | 165 | WP_008807599.1 | DUF1127 domain-containing protein | - |
QLG20_RS23610 (QLG20_23600) | 4843743..4845155 | + | 1413 | WP_008807600.1 | PLP-dependent aminotransferase family protein | - |
QLG20_RS23615 (QLG20_23605) | 4845234..4845536 | - | 303 | WP_022065028.1 | BrnA antitoxin family protein | Antitoxin |
QLG20_RS23620 (QLG20_23610) | 4845523..4845810 | - | 288 | WP_012542979.1 | BrnT family toxin | Toxin |
QLG20_RS23625 (QLG20_23615) | 4845978..4846397 | - | 420 | WP_008807601.1 | FosA5 family fosfomycin resistance glutathione transferase | - |
QLG20_RS23630 (QLG20_23620) | 4846391..4847299 | - | 909 | WP_012542980.1 | LysR family transcriptional regulator | - |
QLG20_RS23635 (QLG20_23625) | 4847386..4848168 | + | 783 | WP_012542981.1 | NAD(P)H-dependent oxidoreductase | - |
QLG20_RS23640 (QLG20_23630) | 4848310..4848894 | + | 585 | WP_004182816.1 | TetR/AcrR family transcriptional regulator | - |
QLG20_RS23645 (QLG20_23635) | 4848916..4849719 | + | 804 | WP_012542983.1 | winged helix-turn-helix domain-containing protein | - |
QLG20_RS23650 (QLG20_23640) | 4849716..4850234 | + | 519 | WP_023297001.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11245.77 Da Isoelectric Point: 8.6574
>T281234 WP_012542979.1 NZ_CP124804:c4845810-4845523 [Klebsiella variicola]
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|