Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4235094..4235713 Replicon chromosome
Accession NZ_CP124804
Organism Klebsiella variicola strain J57

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QLG20_RS20725 Protein ID WP_002892050.1
Coordinates 4235495..4235713 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag QLG20_RS20720 Protein ID WP_008805436.1
Coordinates 4235094..4235468 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG20_RS20710 (QLG20_20700) 4230249..4231442 + 1194 WP_282676256.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QLG20_RS20715 (QLG20_20705) 4231465..4234611 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
QLG20_RS20720 (QLG20_20710) 4235094..4235468 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
QLG20_RS20725 (QLG20_20715) 4235495..4235713 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QLG20_RS20730 (QLG20_20720) 4235872..4236438 + 567 WP_008805435.1 maltose O-acetyltransferase -
QLG20_RS20735 (QLG20_20725) 4236410..4236538 - 129 Protein_4072 hypothetical protein -
QLG20_RS20740 (QLG20_20730) 4236575..4237045 + 471 WP_008805434.1 YlaC family protein -
QLG20_RS20745 (QLG20_20735) 4237014..4238471 - 1458 WP_064170792.1 PLP-dependent aminotransferase family protein -
QLG20_RS20750 (QLG20_20740) 4238572..4239270 + 699 Protein_4075 GNAT family protein -
QLG20_RS20755 (QLG20_20745) 4239267..4239407 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QLG20_RS20760 (QLG20_20750) 4239407..4239670 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281233 WP_002892050.1 NZ_CP124804:4235495-4235713 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT281233 WP_008805436.1 NZ_CP124804:4235094-4235468 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References