Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4235094..4235713 | Replicon | chromosome |
| Accession | NZ_CP124804 | ||
| Organism | Klebsiella variicola strain J57 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QLG20_RS20725 | Protein ID | WP_002892050.1 |
| Coordinates | 4235495..4235713 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1F2MBN7 |
| Locus tag | QLG20_RS20720 | Protein ID | WP_008805436.1 |
| Coordinates | 4235094..4235468 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG20_RS20710 (QLG20_20700) | 4230249..4231442 | + | 1194 | WP_282676256.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QLG20_RS20715 (QLG20_20705) | 4231465..4234611 | + | 3147 | WP_008805437.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QLG20_RS20720 (QLG20_20710) | 4235094..4235468 | + | 375 | WP_008805436.1 | Hha toxicity modulator TomB | Antitoxin |
| QLG20_RS20725 (QLG20_20715) | 4235495..4235713 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QLG20_RS20730 (QLG20_20720) | 4235872..4236438 | + | 567 | WP_008805435.1 | maltose O-acetyltransferase | - |
| QLG20_RS20735 (QLG20_20725) | 4236410..4236538 | - | 129 | Protein_4072 | hypothetical protein | - |
| QLG20_RS20740 (QLG20_20730) | 4236575..4237045 | + | 471 | WP_008805434.1 | YlaC family protein | - |
| QLG20_RS20745 (QLG20_20735) | 4237014..4238471 | - | 1458 | WP_064170792.1 | PLP-dependent aminotransferase family protein | - |
| QLG20_RS20750 (QLG20_20740) | 4238572..4239270 | + | 699 | Protein_4075 | GNAT family protein | - |
| QLG20_RS20755 (QLG20_20745) | 4239267..4239407 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| QLG20_RS20760 (QLG20_20750) | 4239407..4239670 | - | 264 | WP_008805431.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281233 WP_002892050.1 NZ_CP124804:4235495-4235713 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14384.06 Da Isoelectric Point: 4.8989
>AT281233 WP_008805436.1 NZ_CP124804:4235094-4235468 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2MBN7 |