Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1813996..1814586 | Replicon | chromosome |
| Accession | NZ_CP124804 | ||
| Organism | Klebsiella variicola strain J57 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | QLG20_RS08780 | Protein ID | WP_023322934.1 |
| Coordinates | 1814254..1814586 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | QLG20_RS08775 | Protein ID | WP_012541132.1 |
| Coordinates | 1813996..1814253 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG20_RS08755 (QLG20_08750) | 1809606..1810181 | + | 576 | WP_023322936.1 | hypothetical protein | - |
| QLG20_RS08760 (QLG20_08755) | 1810358..1811194 | + | 837 | WP_124037817.1 | alpha/beta hydrolase | - |
| QLG20_RS08765 (QLG20_08760) | 1811401..1812372 | + | 972 | WP_016161433.1 | sensor domain-containing diguanylate cyclase | - |
| QLG20_RS08770 (QLG20_08765) | 1812369..1813469 | - | 1101 | WP_124037818.1 | phosphotransferase | - |
| QLG20_RS08775 (QLG20_08770) | 1813996..1814253 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| QLG20_RS08780 (QLG20_08775) | 1814254..1814586 | + | 333 | WP_023322934.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QLG20_RS08790 (QLG20_08785) | 1814909..1816345 | + | 1437 | WP_042948427.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| QLG20_RS08800 (QLG20_08795) | 1816718..1818172 | - | 1455 | WP_124037819.1 | AMP nucleosidase | - |
| QLG20_RS08805 (QLG20_08800) | 1818303..1818548 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11768.58 Da Isoelectric Point: 9.2926
>T281226 WP_023322934.1 NZ_CP124804:1814254-1814586 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPGTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPGTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|