Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 799302..799959 | Replicon | chromosome |
Accession | NZ_CP124804 | ||
Organism | Klebsiella variicola strain J57 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | QLG20_RS03955 | Protein ID | WP_002916310.1 |
Coordinates | 799549..799959 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QLG20_RS03950 | Protein ID | WP_002916312.1 |
Coordinates | 799302..799568 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG20_RS03920 (QLG20_03920) | 794523..795254 | - | 732 | WP_282676406.1 | MurR/RpiR family transcriptional regulator | - |
QLG20_RS03925 (QLG20_03925) | 795305..795433 | + | 129 | Protein_770 | ASCH domain-containing protein | - |
QLG20_RS03930 (QLG20_03930) | 795445..796521 | - | 1077 | WP_000227969.1 | IS110 family transposase | - |
QLG20_RS03935 (QLG20_03935) | 796805..796990 | + | 186 | Protein_772 | ASCH domain-containing protein | - |
QLG20_RS03940 (QLG20_03940) | 797154..797813 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
QLG20_RS03945 (QLG20_03945) | 798073..799056 | - | 984 | WP_008806428.1 | tRNA-modifying protein YgfZ | - |
QLG20_RS03950 (QLG20_03950) | 799302..799568 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QLG20_RS03955 (QLG20_03955) | 799549..799959 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
QLG20_RS03960 (QLG20_03960) | 799966..800487 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
QLG20_RS03965 (QLG20_03965) | 800588..801484 | + | 897 | WP_124037651.1 | site-specific tyrosine recombinase XerD | - |
QLG20_RS03970 (QLG20_03970) | 801507..802220 | + | 714 | WP_282676292.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QLG20_RS03975 (QLG20_03975) | 802226..803959 | + | 1734 | WP_124037652.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 795445..796521 | 1076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T281224 WP_002916310.1 NZ_CP124804:799549-799959 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |