Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 734161..734936 | Replicon | chromosome |
Accession | NZ_CP124804 | ||
Organism | Klebsiella variicola strain J57 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QLG20_RS03620 | Protein ID | WP_064170005.1 |
Coordinates | 734451..734936 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | QLG20_RS03615 | Protein ID | WP_046881921.1 |
Coordinates | 734161..734454 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG20_RS03595 (QLG20_03595) | 729417..730019 | - | 603 | WP_012540553.1 | short chain dehydrogenase | - |
QLG20_RS03600 (QLG20_03600) | 730117..731028 | + | 912 | WP_124037642.1 | LysR family transcriptional regulator | - |
QLG20_RS03605 (QLG20_03605) | 731029..732177 | - | 1149 | WP_101139729.1 | PLP-dependent aspartate aminotransferase family protein | - |
QLG20_RS03610 (QLG20_03610) | 732189..733565 | - | 1377 | WP_016161835.1 | cystathionine beta-synthase | - |
QLG20_RS03615 (QLG20_03615) | 734161..734454 | + | 294 | WP_046881921.1 | DUF1778 domain-containing protein | Antitoxin |
QLG20_RS03620 (QLG20_03620) | 734451..734936 | + | 486 | WP_064170005.1 | GNAT family N-acetyltransferase | Toxin |
QLG20_RS03625 (QLG20_03625) | 735640..736232 | + | 593 | Protein_712 | hypothetical protein | - |
QLG20_RS03630 (QLG20_03630) | 736329..736545 | + | 217 | Protein_713 | transposase | - |
QLG20_RS03640 (QLG20_03640) | 737061..737774 | - | 714 | WP_008806478.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 736329..736481 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17618.64 Da Isoelectric Point: 8.5178
>T281223 WP_064170005.1 NZ_CP124804:734451-734936 [Klebsiella variicola]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDGKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMLMVTLRDLVH
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDGKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMLMVTLRDLVH
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|