Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 196868..197628 | Replicon | chromosome |
Accession | NZ_CP124804 | ||
Organism | Klebsiella variicola strain J57 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | QLG20_RS00960 | Protein ID | WP_124037534.1 |
Coordinates | 197143..197628 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | QLG20_RS00955 | Protein ID | WP_124037532.1 |
Coordinates | 196868..197155 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG20_RS00930 (QLG20_00930) | 191902..193074 | + | 1173 | WP_124037526.1 | MFS transporter | - |
QLG20_RS00935 (QLG20_00935) | 193205..194191 | + | 987 | WP_178075512.1 | LacI family DNA-binding transcriptional regulator | - |
QLG20_RS00940 (QLG20_00940) | 194252..195382 | - | 1131 | WP_095033069.1 | YvcK family protein | - |
QLG20_RS00945 (QLG20_00945) | 195617..196204 | + | 588 | WP_167382661.1 | sugar O-acetyltransferase | - |
QLG20_RS00950 (QLG20_00950) | 196220..196744 | + | 525 | WP_124037530.1 | phosphoribosyltransferase family protein | - |
QLG20_RS00955 (QLG20_00955) | 196868..197155 | + | 288 | WP_124037532.1 | DUF1778 domain-containing protein | Antitoxin |
QLG20_RS00960 (QLG20_00960) | 197143..197628 | + | 486 | WP_124037534.1 | GNAT family N-acetyltransferase | Toxin |
QLG20_RS00965 (QLG20_00965) | 197969..198121 | + | 153 | WP_012967075.1 | type I toxin-antitoxin system toxin HokA | - |
QLG20_RS00970 (QLG20_00970) | 198423..200042 | + | 1620 | WP_072125586.1 | ATP-binding cassette domain-containing protein | - |
QLG20_RS00975 (QLG20_00975) | 200141..200353 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
QLG20_RS00980 (QLG20_00980) | 200606..200896 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
QLG20_RS00985 (QLG20_00985) | 201142..202497 | - | 1356 | WP_008806885.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17697.41 Da Isoelectric Point: 9.1865
>T281221 WP_124037534.1 NZ_CP124804:197143-197628 [Klebsiella variicola]
VGSLTAPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEANNFYIHHGFKPSQTQQRTLFLKLP
Q
VGSLTAPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEANNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|