Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1800322..1800953 | Replicon | chromosome |
| Accession | NZ_CP124777 | ||
| Organism | Lachnoanaerobaculum gingivalis strain SHL-20230108WGSARO1-L360107582 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QJR73_RS08465 | Protein ID | WP_282668493.1 |
| Coordinates | 1800322..1800729 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | K0XI72 |
| Locus tag | QJR73_RS08470 | Protein ID | WP_007593116.1 |
| Coordinates | 1800726..1800953 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR73_RS08445 (QJR73_08445) | 1797979..1798284 | - | 306 | WP_128673028.1 | ribosomal L7Ae/L30e/S12e/Gadd45 family protein | - |
| QJR73_RS08450 (QJR73_08450) | 1798271..1798555 | - | 285 | WP_128673029.1 | YlxR family protein | - |
| QJR73_RS08455 (QJR73_08455) | 1798533..1799720 | - | 1188 | WP_128673030.1 | transcription termination factor NusA | - |
| QJR73_RS08460 (QJR73_08460) | 1799739..1800245 | - | 507 | WP_282668492.1 | ribosome maturation factor RimP | - |
| QJR73_RS08465 (QJR73_08465) | 1800322..1800729 | - | 408 | WP_282668493.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJR73_RS08470 (QJR73_08470) | 1800726..1800953 | - | 228 | WP_007593116.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJR73_RS08475 (QJR73_08475) | 1801061..1801747 | - | 687 | WP_282668494.1 | SH3 domain-containing protein | - |
| QJR73_RS08480 (QJR73_08480) | 1801758..1802786 | - | 1029 | WP_282668495.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QJR73_RS08485 (QJR73_08485) | 1803052..1804896 | + | 1845 | WP_282668496.1 | VWA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15313.85 Da Isoelectric Point: 6.2236
>T281220 WP_282668493.1 NZ_CP124777:c1800729-1800322 [Lachnoanaerobaculum gingivalis]
MRYMLDTNICIYIIKNKPESVVKELKRHDPTEICISAITYAELIHGVEKSMAVDKNRLALTLLLSNIEVLDFDINAANNY
GKIRTYLEKQGTPIGPLDMMIAAHAQSLGYSIVTNNIKEFMRVPNLEVCNWVEQA
MRYMLDTNICIYIIKNKPESVVKELKRHDPTEICISAITYAELIHGVEKSMAVDKNRLALTLLLSNIEVLDFDINAANNY
GKIRTYLEKQGTPIGPLDMMIAAHAQSLGYSIVTNNIKEFMRVPNLEVCNWVEQA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|