Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1266220..1266710 | Replicon | chromosome |
| Accession | NZ_CP124777 | ||
| Organism | Lachnoanaerobaculum gingivalis strain SHL-20230108WGSARO1-L360107582 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QJR73_RS05905 | Protein ID | WP_282670097.1 |
| Coordinates | 1266441..1266710 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | W2VCG7 |
| Locus tag | QJR73_RS05900 | Protein ID | WP_034213986.1 |
| Coordinates | 1266220..1266444 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR73_RS05895 (QJR73_05895) | 1265482..1266129 | + | 648 | WP_282670096.1 | hypothetical protein | - |
| QJR73_RS05900 (QJR73_05900) | 1266220..1266444 | + | 225 | WP_034213986.1 | DUF6290 family protein | Antitoxin |
| QJR73_RS05905 (QJR73_05905) | 1266441..1266710 | + | 270 | WP_282670097.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJR73_RS05910 (QJR73_05910) | 1266786..1267142 | + | 357 | WP_282670098.1 | YlxM family DNA-binding protein | - |
| QJR73_RS05915 (QJR73_05915) | 1267152..1268507 | + | 1356 | WP_282670099.1 | signal recognition particle protein | - |
| QJR73_RS05920 (QJR73_05920) | 1268576..1268818 | + | 243 | WP_007591924.1 | 30S ribosomal protein S16 | - |
| QJR73_RS05925 (QJR73_05925) | 1268831..1269058 | + | 228 | WP_009218659.1 | KH domain-containing protein | - |
| QJR73_RS05930 (QJR73_05930) | 1269136..1269645 | + | 510 | WP_282670100.1 | ribosome maturation factor RimM | - |
| QJR73_RS05935 (QJR73_05935) | 1269648..1270397 | + | 750 | WP_282670101.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| QJR73_RS05940 (QJR73_05940) | 1270390..1271502 | + | 1113 | WP_282670102.1 | DUF4317 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10610.38 Da Isoelectric Point: 10.1905
>T281219 WP_282670097.1 NZ_CP124777:1266441-1266710 [Lachnoanaerobaculum gingivalis]
MIYEISTTEKFDKALKKLDRQTQRIIKAWIEKNLINCENPRIHGKALTANRSGQWRYRVGDYRILAEIHDNKLVLILIDV
GHRKDIYLF
MIYEISTTEKFDKALKKLDRQTQRIIKAWIEKNLINCENPRIHGKALTANRSGQWRYRVGDYRILAEIHDNKLVLILIDV
GHRKDIYLF
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|