Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4188793..4189462 | Replicon | chromosome |
Accession | NZ_CP124754 | ||
Organism | Serratia sp. K-E0102 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2V4FX75 |
Locus tag | SSARUM2_RS19915 | Protein ID | WP_033649453.1 |
Coordinates | 4188793..4189215 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
Locus tag | SSARUM2_RS19920 | Protein ID | WP_004931679.1 |
Coordinates | 4189196..4189462 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM2_RS19895 (SSARUM2_003979) | 4184682..4185200 | + | 519 | WP_033635825.1 | flavodoxin FldB | - |
SSARUM2_RS19900 (SSARUM2_003980) | 4185238..4186602 | - | 1365 | WP_041036554.1 | cell envelope integrity protein CreD | - |
SSARUM2_RS19905 (SSARUM2_003981) | 4186683..4188101 | - | 1419 | WP_033654070.1 | two-component system sensor histidine kinase CreC | - |
SSARUM2_RS19910 (SSARUM2_003982) | 4188098..4188793 | - | 696 | WP_049232287.1 | two-component system response regulator CreB | - |
SSARUM2_RS19915 (SSARUM2_003983) | 4188793..4189215 | - | 423 | WP_033649453.1 | protein YgfX | Toxin |
SSARUM2_RS19920 (SSARUM2_003984) | 4189196..4189462 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
SSARUM2_RS19925 (SSARUM2_003985) | 4189783..4190775 | + | 993 | WP_049194803.1 | tRNA-modifying protein YgfZ | - |
SSARUM2_RS19930 (SSARUM2_003986) | 4190814..4191311 | - | 498 | WP_033649451.1 | DUF2165 domain-containing protein | - |
SSARUM2_RS19935 (SSARUM2_003987) | 4191462..4192136 | - | 675 | WP_038871224.1 | hemolysin III family protein | - |
SSARUM2_RS19940 (SSARUM2_003988) | 4192320..4192928 | + | 609 | WP_025304127.1 | HD domain-containing protein | - |
SSARUM2_RS19945 (SSARUM2_003989) | 4192961..4193887 | - | 927 | WP_033635835.1 | ribokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16471.59 Da Isoelectric Point: 10.8114
>T281216 WP_033649453.1 NZ_CP124754:c4189215-4188793 [Serratia sp. K-E0102]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAAQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLLPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEDP
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAAQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLLPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEDP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|