Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3827652..3828308 | Replicon | chromosome |
Accession | NZ_CP124754 | ||
Organism | Serratia sp. K-E0102 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | SSARUM2_RS18230 | Protein ID | WP_060453052.1 |
Coordinates | 3827652..3828041 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
Locus tag | SSARUM2_RS18235 | Protein ID | WP_004941563.1 |
Coordinates | 3828045..3828308 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM2_RS18215 (SSARUM2_003643) | 3824119..3825549 | + | 1431 | WP_060453051.1 | MFS transporter | - |
SSARUM2_RS18220 (SSARUM2_003644) | 3825546..3826928 | + | 1383 | WP_033635541.1 | two-component system sensor histidine kinase BaeS | - |
SSARUM2_RS18225 (SSARUM2_003645) | 3826928..3827644 | + | 717 | WP_033635542.1 | two-component system response regulator BaeR | - |
SSARUM2_RS18230 (SSARUM2_003646) | 3827652..3828041 | - | 390 | WP_060453052.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
SSARUM2_RS18235 (SSARUM2_003647) | 3828045..3828308 | - | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
SSARUM2_RS18240 (SSARUM2_003648) | 3828648..3828986 | + | 339 | WP_033648841.1 | YegP family protein | - |
SSARUM2_RS18245 (SSARUM2_003649) | 3829167..3830519 | + | 1353 | WP_033635545.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
SSARUM2_RS18250 (SSARUM2_003650) | 3830986..3831891 | + | 906 | WP_033635546.1 | lipid kinase YegS | - |
SSARUM2_RS18255 (SSARUM2_003651) | 3832181..3833230 | + | 1050 | WP_033635553.1 | class I fructose-bisphosphate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14293.56 Da Isoelectric Point: 7.7751
>T281214 WP_060453052.1 NZ_CP124754:c3828041-3827652 [Serratia sp. K-E0102]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISCVTEAELLYGVAKRRNKALQSVVEAFLAAVTVYAWDSEAARCYGEM
RANMEKKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISCVTEAELLYGVAKRRNKALQSVVEAFLAAVTVYAWDSEAARCYGEM
RANMEKKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|