Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 14716..15317 | Replicon | chromosome |
Accession | NZ_CP124754 | ||
Organism | Serratia sp. K-E0102 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2V4FS51 |
Locus tag | SSARUM2_RS00070 | Protein ID | WP_033649548.1 |
Coordinates | 14716..15096 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A086G6A0 |
Locus tag | SSARUM2_RS00075 | Protein ID | WP_004933932.1 |
Coordinates | 15096..15317 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM2_RS00045 (SSARUM2_000009) | 9969..11249 | + | 1281 | WP_047569945.1 | DUF3748 domain-containing protein | - |
SSARUM2_RS00050 (SSARUM2_000010) | 11280..11627 | - | 348 | WP_033636538.1 | YceK/YidQ family lipoprotein | - |
SSARUM2_RS00055 (SSARUM2_000011) | 11938..12351 | + | 414 | WP_004933919.1 | small heat shock chaperone IbpA | - |
SSARUM2_RS00060 (SSARUM2_000012) | 12452..12880 | + | 429 | WP_004933922.1 | small heat shock chaperone IbpB | - |
SSARUM2_RS00065 (SSARUM2_000013) | 13047..14705 | + | 1659 | WP_033649549.1 | putative transporter | - |
SSARUM2_RS00070 (SSARUM2_000014) | 14716..15096 | - | 381 | WP_033649548.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
SSARUM2_RS00075 (SSARUM2_000015) | 15096..15317 | - | 222 | WP_004933932.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
SSARUM2_RS00080 (SSARUM2_000016) | 15393..16643 | - | 1251 | WP_033645138.1 | valine--pyruvate transaminase | - |
SSARUM2_RS00085 (SSARUM2_000017) | 16779..18842 | - | 2064 | WP_060439328.1 | alpha-amylase | - |
SSARUM2_RS00090 (SSARUM2_000018) | 19039..19191 | + | 153 | WP_019455508.1 | hypothetical protein | - |
SSARUM2_RS00095 (SSARUM2_000019) | 19193..20170 | - | 978 | WP_033636542.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14171.50 Da Isoelectric Point: 7.3170
>T281203 WP_033649548.1 NZ_CP124754:c15096-14716 [Serratia sp. K-E0102]
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIVWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIVWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V4FS51 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086G6A0 |