Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4095952..4096621 | Replicon | chromosome |
| Accession | NZ_CP124750 | ||
| Organism | Serratia sp. K-M0706 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2V4FX75 |
| Locus tag | SSARUM_RS19420 | Protein ID | WP_033649453.1 |
| Coordinates | 4095952..4096374 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
| Locus tag | SSARUM_RS19425 | Protein ID | WP_004931679.1 |
| Coordinates | 4096355..4096621 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSARUM_RS19400 (SSARUM_003880) | 4091841..4092359 | + | 519 | WP_033635825.1 | flavodoxin FldB | - |
| SSARUM_RS19405 (SSARUM_003881) | 4092397..4093761 | - | 1365 | WP_060431066.1 | cell envelope integrity protein CreD | - |
| SSARUM_RS19410 (SSARUM_003882) | 4093842..4095260 | - | 1419 | WP_033649455.1 | two-component system sensor histidine kinase CreC | - |
| SSARUM_RS19415 (SSARUM_003883) | 4095257..4095952 | - | 696 | WP_033649454.1 | two-component system response regulator CreB | - |
| SSARUM_RS19420 (SSARUM_003884) | 4095952..4096374 | - | 423 | WP_033649453.1 | protein YgfX | Toxin |
| SSARUM_RS19425 (SSARUM_003885) | 4096355..4096621 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
| SSARUM_RS19430 (SSARUM_003886) | 4096942..4097934 | + | 993 | WP_033649452.1 | tRNA-modifying protein YgfZ | - |
| SSARUM_RS19435 (SSARUM_003887) | 4097973..4098470 | - | 498 | WP_033649451.1 | DUF2165 domain-containing protein | - |
| SSARUM_RS19440 (SSARUM_003888) | 4098621..4099295 | - | 675 | WP_033649450.1 | hemolysin III family protein | - |
| SSARUM_RS19445 (SSARUM_003889) | 4099479..4100087 | + | 609 | WP_025304127.1 | HD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16471.59 Da Isoelectric Point: 10.8114
>T281200 WP_033649453.1 NZ_CP124750:c4096374-4095952 [Serratia sp. K-M0706]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAAQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLLPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEDP
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAAQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLLPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEDP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|