Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3731910..3732566 | Replicon | chromosome |
| Accession | NZ_CP124750 | ||
| Organism | Serratia sp. K-M0706 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A2V4G0W2 |
| Locus tag | SSARUM_RS17705 | Protein ID | WP_041036282.1 |
| Coordinates | 3731910..3732299 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
| Locus tag | SSARUM_RS17710 | Protein ID | WP_004941563.1 |
| Coordinates | 3732303..3732566 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSARUM_RS17690 (SSARUM_003538) | 3728377..3729807 | + | 1431 | WP_060430454.1 | multidrug transporter subunit MdtD | - |
| SSARUM_RS17695 (SSARUM_003539) | 3729804..3731186 | + | 1383 | WP_033635541.1 | two-component system sensor histidine kinase BaeS | - |
| SSARUM_RS17700 (SSARUM_003540) | 3731186..3731902 | + | 717 | WP_033635542.1 | two-component system response regulator BaeR | - |
| SSARUM_RS17705 (SSARUM_003541) | 3731910..3732299 | - | 390 | WP_041036282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| SSARUM_RS17710 (SSARUM_003542) | 3732303..3732566 | - | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| SSARUM_RS17715 (SSARUM_003543) | 3732906..3733244 | + | 339 | WP_033635544.1 | YegP family protein | - |
| SSARUM_RS17720 (SSARUM_003544) | 3733425..3734777 | + | 1353 | WP_033635545.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
| SSARUM_RS17725 (SSARUM_003545) | 3735244..3736149 | + | 906 | WP_033635546.1 | lipid kinase YegS | - |
| SSARUM_RS17730 (SSARUM_003546) | 3736439..3737488 | + | 1050 | WP_033635553.1 | class I fructose-bisphosphate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14309.56 Da Isoelectric Point: 7.8786
>T281198 WP_041036282.1 NZ_CP124750:c3732299-3731910 [Serratia sp. K-M0706]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMEKKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMEKKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|