Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1691346..1691871 | Replicon | chromosome |
Accession | NZ_CP124750 | ||
Organism | Serratia sp. K-M0706 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2S4XEJ2 |
Locus tag | SSARUM_RS08055 | Protein ID | WP_033654647.1 |
Coordinates | 1691346..1691630 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A8B4GIN1 |
Locus tag | SSARUM_RS08060 | Protein ID | WP_004928423.1 |
Coordinates | 1691620..1691871 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM_RS08030 (SSARUM_001606) | 1686606..1687739 | + | 1134 | WP_060429812.1 | putrescine ABC transporter ATP-binding subunit PotG | - |
SSARUM_RS08035 (SSARUM_001607) | 1687764..1688726 | + | 963 | WP_033646669.1 | putrescine ABC transporter permease PotH | - |
SSARUM_RS08040 (SSARUM_001608) | 1688723..1689568 | + | 846 | WP_060429814.1 | putrescine ABC transporter permease PotI | - |
SSARUM_RS08045 (SSARUM_001609) | 1689673..1690152 | + | 480 | WP_049197168.1 | YbjO family protein | - |
SSARUM_RS08050 (SSARUM_001610) | 1690222..1691349 | + | 1128 | WP_060429816.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
SSARUM_RS08055 (SSARUM_001611) | 1691346..1691630 | - | 285 | WP_033654647.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SSARUM_RS08060 (SSARUM_001612) | 1691620..1691871 | - | 252 | WP_004928423.1 | prevent-host-death protein | Antitoxin |
SSARUM_RS08065 (SSARUM_001613) | 1691973..1692707 | - | 735 | WP_043147094.1 | arginine ABC transporter substrate-binding protein | - |
SSARUM_RS08070 (SSARUM_001614) | 1692905..1693573 | - | 669 | WP_033637817.1 | arginine ABC transporter permease ArtM | - |
SSARUM_RS08075 (SSARUM_001615) | 1693573..1694289 | - | 717 | WP_033637818.1 | arginine ABC transporter permease ArtQ | - |
SSARUM_RS08080 (SSARUM_001616) | 1694299..1695030 | - | 732 | WP_033637819.1 | arginine ABC transporter substrate-binding protein | - |
SSARUM_RS08085 (SSARUM_001617) | 1695063..1695791 | - | 729 | WP_038884338.1 | arginine ABC transporter ATP-binding protein ArtP | - |
SSARUM_RS08090 (SSARUM_001618) | 1696056..1696598 | - | 543 | WP_033637821.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10817.97 Da Isoelectric Point: 10.6941
>T281192 WP_033654647.1 NZ_CP124750:c1691630-1691346 [Serratia sp. K-M0706]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLVSVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
MTYKLEFEEHALKEFKKLSPVIREQFKKKLVSVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4XEJ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4GIN1 |