Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1691346..1691871 Replicon chromosome
Accession NZ_CP124750
Organism Serratia sp. K-M0706

Toxin (Protein)


Gene name relE Uniprot ID A0A2S4XEJ2
Locus tag SSARUM_RS08055 Protein ID WP_033654647.1
Coordinates 1691346..1691630 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A8B4GIN1
Locus tag SSARUM_RS08060 Protein ID WP_004928423.1
Coordinates 1691620..1691871 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SSARUM_RS08030 (SSARUM_001606) 1686606..1687739 + 1134 WP_060429812.1 putrescine ABC transporter ATP-binding subunit PotG -
SSARUM_RS08035 (SSARUM_001607) 1687764..1688726 + 963 WP_033646669.1 putrescine ABC transporter permease PotH -
SSARUM_RS08040 (SSARUM_001608) 1688723..1689568 + 846 WP_060429814.1 putrescine ABC transporter permease PotI -
SSARUM_RS08045 (SSARUM_001609) 1689673..1690152 + 480 WP_049197168.1 YbjO family protein -
SSARUM_RS08050 (SSARUM_001610) 1690222..1691349 + 1128 WP_060429816.1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC -
SSARUM_RS08055 (SSARUM_001611) 1691346..1691630 - 285 WP_033654647.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
SSARUM_RS08060 (SSARUM_001612) 1691620..1691871 - 252 WP_004928423.1 prevent-host-death protein Antitoxin
SSARUM_RS08065 (SSARUM_001613) 1691973..1692707 - 735 WP_043147094.1 arginine ABC transporter substrate-binding protein -
SSARUM_RS08070 (SSARUM_001614) 1692905..1693573 - 669 WP_033637817.1 arginine ABC transporter permease ArtM -
SSARUM_RS08075 (SSARUM_001615) 1693573..1694289 - 717 WP_033637818.1 arginine ABC transporter permease ArtQ -
SSARUM_RS08080 (SSARUM_001616) 1694299..1695030 - 732 WP_033637819.1 arginine ABC transporter substrate-binding protein -
SSARUM_RS08085 (SSARUM_001617) 1695063..1695791 - 729 WP_038884338.1 arginine ABC transporter ATP-binding protein ArtP -
SSARUM_RS08090 (SSARUM_001618) 1696056..1696598 - 543 WP_033637821.1 lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10817.97 Da        Isoelectric Point: 10.6941

>T281192 WP_033654647.1 NZ_CP124750:c1691630-1691346 [Serratia sp. K-M0706]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLVSVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9108.39 Da        Isoelectric Point: 4.5203

>AT281192 WP_004928423.1 NZ_CP124750:c1691871-1691620 [Serratia sp. K-M0706]
MTVQPILADSAVSISDFKKSPNAALKEAQGQPVAVLTNGKISGYYVSPETWEAIAEYLEDIELAEIVRSRMNGKRIKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4XEJ2

Antitoxin

Source ID Structure
AlphaFold DB A0A8B4GIN1

References