Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1553658..1554211 | Replicon | chromosome |
Accession | NZ_CP124750 | ||
Organism | Serratia sp. K-M0706 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A2V4FZ31 |
Locus tag | SSARUM_RS07425 | Protein ID | WP_019454426.1 |
Coordinates | 1553897..1554211 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | SSARUM_RS07420 | Protein ID | WP_039566839.1 |
Coordinates | 1553658..1553894 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM_RS07405 (SSARUM_001481) | 1550125..1551660 | + | 1536 | WP_033646792.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
SSARUM_RS07410 (SSARUM_001482) | 1551713..1552633 | + | 921 | WP_033637716.1 | glutathione ABC transporter permease GsiC | - |
SSARUM_RS07415 (SSARUM_001483) | 1552643..1553551 | + | 909 | WP_019454428.1 | glutathione ABC transporter permease GsiD | - |
SSARUM_RS07420 (SSARUM_001484) | 1553658..1553894 | + | 237 | WP_039566839.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
SSARUM_RS07425 (SSARUM_001485) | 1553897..1554211 | + | 315 | WP_019454426.1 | CcdB family protein | Toxin |
SSARUM_RS07430 (SSARUM_001486) | 1554251..1555093 | - | 843 | WP_033654970.1 | S-formylglutathione hydrolase | - |
SSARUM_RS07435 (SSARUM_001487) | 1555108..1556232 | - | 1125 | WP_033637718.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
SSARUM_RS07440 (SSARUM_001488) | 1556263..1557183 | - | 921 | WP_033654969.1 | LysR family transcriptional regulator | - |
SSARUM_RS07445 (SSARUM_001489) | 1557289..1558446 | + | 1158 | WP_060387473.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11745.68 Da Isoelectric Point: 5.0488
>T281191 WP_019454426.1 NZ_CP124750:1553897-1554211 [Serratia sp. K-M0706]
MQFTVYANRGNSAVYPLLLDVTSDIIGQLNRRVVIPLLPVEKYPGSTRPERLIPLIRLIDDNEYAVMTYEMASIPVRALG
AEFCDVSQYRTRIKAAIDFLLDGI
MQFTVYANRGNSAVYPLLLDVTSDIIGQLNRRVVIPLLPVEKYPGSTRPERLIPLIRLIDDNEYAVMTYEMASIPVRALG
AEFCDVSQYRTRIKAAIDFLLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|