Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1085928..1086549 Replicon chromosome
Accession NZ_CP124750
Organism Serratia sp. K-M0706

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag SSARUM_RS05090 Protein ID WP_004940313.1
Coordinates 1085928..1086131 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag SSARUM_RS05095 Protein ID WP_004940312.1
Coordinates 1086181..1086549 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SSARUM_RS05065 (SSARUM_001013) 1081719..1082165 + 447 WP_033647279.1 type II secretion system protein GspM -
SSARUM_RS05070 (SSARUM_001014) 1082202..1083017 + 816 WP_060426613.1 A24 family peptidase -
SSARUM_RS05075 (SSARUM_001015) 1083014..1083376 - 363 WP_060429632.1 type II secretion system pilot lipoprotein GspS -
SSARUM_RS05080 (SSARUM_001016) 1083630..1085060 + 1431 WP_033637339.1 N-acetylglucosamine-binding protein GbpA -
SSARUM_RS05085 (SSARUM_001017) 1085113..1085631 + 519 WP_033647275.1 cytochrome b/b6 domain-containing protein -
SSARUM_RS05090 (SSARUM_001018) 1085928..1086131 - 204 WP_004940313.1 HHA domain-containing protein Toxin
SSARUM_RS05095 (SSARUM_001019) 1086181..1086549 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
SSARUM_RS05100 (SSARUM_001020) 1086708..1087061 - 354 WP_060422005.1 hypothetical protein -
SSARUM_RS05105 (SSARUM_001021) 1087468..1088181 + 714 WP_033647273.1 ABC transporter ATP-binding protein -
SSARUM_RS05110 (SSARUM_001022) 1088178..1089035 + 858 WP_060426364.1 metal ABC transporter permease -
SSARUM_RS05115 (SSARUM_001023) 1089061..1089939 + 879 WP_060429634.1 metal ABC transporter substrate-binding protein -
SSARUM_RS05120 (SSARUM_001024) 1090046..1090186 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
SSARUM_RS05125 (SSARUM_001025) 1090199..1090453 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T281190 WP_004940313.1 NZ_CP124750:c1086131-1085928 [Serratia sp. K-M0706]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT281190 WP_004940312.1 NZ_CP124750:c1086549-1086181 [Serratia sp. K-M0706]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References