Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 14161..14762 | Replicon | chromosome |
| Accession | NZ_CP124750 | ||
| Organism | Serratia sp. K-M0706 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A2V4FS51 |
| Locus tag | SSARUM_RS00070 | Protein ID | WP_033649548.1 |
| Coordinates | 14161..14541 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2S4X5L5 |
| Locus tag | SSARUM_RS00075 | Protein ID | WP_039568270.1 |
| Coordinates | 14541..14762 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSARUM_RS00045 (SSARUM_000009) | 9414..10694 | + | 1281 | WP_033649550.1 | DUF3748 domain-containing protein | - |
| SSARUM_RS00050 (SSARUM_000010) | 10725..11072 | - | 348 | WP_033636538.1 | YceK/YidQ family lipoprotein | - |
| SSARUM_RS00055 (SSARUM_000011) | 11383..11796 | + | 414 | WP_004933919.1 | small heat shock chaperone IbpA | - |
| SSARUM_RS00060 (SSARUM_000012) | 11897..12325 | + | 429 | WP_004933922.1 | small heat shock chaperone IbpB | - |
| SSARUM_RS00065 (SSARUM_000013) | 12492..14150 | + | 1659 | WP_033649549.1 | putative transporter | - |
| SSARUM_RS00070 (SSARUM_000014) | 14161..14541 | - | 381 | WP_033649548.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| SSARUM_RS00075 (SSARUM_000015) | 14541..14762 | - | 222 | WP_039568270.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| SSARUM_RS00080 (SSARUM_000016) | 14838..16088 | - | 1251 | WP_060388266.1 | valine--pyruvate transaminase | - |
| SSARUM_RS00085 (SSARUM_000017) | 16224..18287 | - | 2064 | WP_060388267.1 | alpha-amylase | - |
| SSARUM_RS00090 (SSARUM_000018) | 18484..18636 | + | 153 | WP_019455508.1 | hypothetical protein | - |
| SSARUM_RS00095 (SSARUM_000019) | 18638..19615 | - | 978 | WP_060431252.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14171.50 Da Isoelectric Point: 7.3170
>T281186 WP_033649548.1 NZ_CP124750:c14541-14161 [Serratia sp. K-M0706]
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIVWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIVWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V4FS51 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4X5L5 |