Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3969940..3970589 | Replicon | chromosome |
| Accession | NZ_CP124744 | ||
| Organism | Proteus mirabilis strain WSY-114 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B4EZB9 |
| Locus tag | QJS45_RS18285 | Protein ID | WP_012368534.1 |
| Coordinates | 3970170..3970589 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B4EZC0 |
| Locus tag | QJS45_RS18280 | Protein ID | WP_012368535.1 |
| Coordinates | 3969940..3970173 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJS45_RS18270 (QJS45_18270) | 3965584..3966993 | - | 1410 | WP_004246801.1 | glutamate--ammonia ligase | - |
| QJS45_RS18275 (QJS45_18275) | 3967353..3969188 | + | 1836 | WP_004246802.1 | ribosome-dependent GTPase TypA | - |
| QJS45_RS18280 (QJS45_18280) | 3969940..3970173 | + | 234 | WP_012368535.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJS45_RS18285 (QJS45_18285) | 3970170..3970589 | + | 420 | WP_012368534.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJS45_RS18290 (QJS45_18290) | 3970859..3971137 | + | 279 | WP_230629709.1 | hypothetical protein | - |
| QJS45_RS18295 (QJS45_18295) | 3971115..3971531 | + | 417 | WP_046334846.1 | hypothetical protein | - |
| QJS45_RS18300 (QJS45_18300) | 3972184..3972801 | + | 618 | WP_020946398.1 | glucose-1-phosphatase | - |
| QJS45_RS18305 (QJS45_18305) | 3972882..3973319 | + | 438 | WP_004246810.1 | D-aminoacyl-tRNA deacylase | - |
| QJS45_RS18310 (QJS45_18310) | 3973343..3974257 | + | 915 | WP_004246811.1 | fatty acid biosynthesis protein FabY | - |
| QJS45_RS18315 (QJS45_18315) | 3974433..3975311 | + | 879 | WP_282473343.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15371.88 Da Isoelectric Point: 7.7288
>T281185 WP_012368534.1 NZ_CP124744:3970170-3970589 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|