Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2230870..2231515 | Replicon | chromosome |
| Accession | NZ_CP124744 | ||
| Organism | Proteus mirabilis strain WSY-114 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B4ET86 |
| Locus tag | QJS45_RS10325 | Protein ID | WP_004247035.1 |
| Coordinates | 2230870..2231055 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QJS45_RS10330 | Protein ID | WP_227201465.1 |
| Coordinates | 2231102..2231515 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJS45_RS10280 (QJS45_10280) | 2226962..2227345 | - | 384 | WP_060555090.1 | hypothetical protein | - |
| QJS45_RS10285 (QJS45_10285) | 2227426..2227560 | - | 135 | Protein_2007 | site-specific integrase | - |
| QJS45_RS10290 (QJS45_10290) | 2227547..2227882 | - | 336 | WP_060555092.1 | hypothetical protein | - |
| QJS45_RS10295 (QJS45_10295) | 2228499..2228774 | + | 276 | WP_227201464.1 | hypothetical protein | - |
| QJS45_RS10300 (QJS45_10300) | 2228960..2229430 | + | 471 | WP_004247039.1 | PH domain-containing protein | - |
| QJS45_RS10305 (QJS45_10305) | 2229543..2229695 | - | 153 | WP_004247038.1 | hypothetical protein | - |
| QJS45_RS10310 (QJS45_10310) | 2229765..2229983 | - | 219 | Protein_2012 | hypothetical protein | - |
| QJS45_RS10315 (QJS45_10315) | 2229986..2230354 | - | 369 | WP_223232026.1 | DUF1073 domain-containing protein | - |
| QJS45_RS10320 (QJS45_10320) | 2230297..2230764 | - | 468 | WP_282473217.1 | hypothetical protein | - |
| QJS45_RS10325 (QJS45_10325) | 2230870..2231055 | + | 186 | WP_004247035.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QJS45_RS10330 (QJS45_10330) | 2231102..2231515 | + | 414 | WP_227201465.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QJS45_RS10335 (QJS45_10335) | 2231611..2232111 | + | 501 | WP_041707083.1 | response regulator | - |
| QJS45_RS10340 (QJS45_10340) | 2232476..2232718 | + | 243 | WP_230458803.1 | hypothetical protein | - |
| QJS45_RS10345 (QJS45_10345) | 2232831..2233409 | - | 579 | WP_004247030.1 | alpha/beta hydrolase | - |
| QJS45_RS10350 (QJS45_10350) | 2234259..2235005 | + | 747 | Protein_2020 | methyltransferase domain-containing protein | - |
| QJS45_RS10355 (QJS45_10355) | 2235182..2235358 | - | 177 | WP_004247026.1 | hypothetical protein | - |
| QJS45_RS10360 (QJS45_10360) | 2235810..2235968 | + | 159 | WP_004247025.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2176888..2237652 | 60764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7049.30 Da Isoelectric Point: 10.9659
>T281183 WP_004247035.1 NZ_CP124744:2230870-2231055 [Proteus mirabilis]
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15250.99 Da Isoelectric Point: 4.4531
>AT281183 WP_227201465.1 NZ_CP124744:2231102-2231515 [Proteus mirabilis]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGNSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
MLYPAFIEIDEDGSASGWFPDIDGCIFAGNSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|