281179

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 73102..73661 Replicon plasmid unnamed3
Accession NZ_CP124743
Organism Escherichia coli O157:H7 str. EDL933

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag QI555_RS28770 Protein ID WP_000421248.1
Coordinates 73386..73661 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QI555_RS28765 Protein ID WP_001178089.1
Coordinates 73102..73386 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QI555_RS28725 (68435) 68435..68854 + 420 Protein_68 fertility inhibition protein FinO -
QI555_RS28730 (68987) 68987..69199 + 213 WP_001302189.1 ANR family transcriptional regulator -
QI555_RS28735 (69444) 69444..69905 + 462 WP_001233853.1 thermonuclease family protein -
QI555_RS28740 (69951) 69951..70160 + 210 WP_001302200.1 hemolysin expression modulator Hha -
QI555_RS28745 (70198) 70198..70536 + 339 WP_000766796.1 hypothetical protein -
QI555_RS28750 (70776) 70776..71030 + 255 WP_000083831.1 replication regulatory protein RepA -
QI555_RS28755 (71266) 71266..71340 + 75 WP_001370046.1 RepA leader peptide Tap -
QI555_RS28760 (71333) 71333..72190 + 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
QI555_RS28765 (73102) 73102..73386 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QI555_RS28770 (73386) 73386..73661 + 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QI555_RS28775 (73756) 73756..73962 + 207 WP_001105064.1 hypothetical protein -
QI555_RS28780 (74062) 74062..74277 - 216 Protein_79 transposase -
QI555_RS28785 (74321) 74321..74887 - 567 Protein_80 IS3-like element IS600 family transposase -
QI555_RS28790 (74887) 74887..75303 - 417 Protein_81 IS91 family transposase -
QI555_RS28795 (75303) 75303..75488 - 186 WP_001302179.1 hypothetical protein -
QI555_RS28800 (75665) 75665..77875 + 2211 WP_000592771.1 catalase/peroxidase KatP -
QI555_RS28805 (77919) 77919..78308 + 390 WP_001172748.1 cytochrome b562 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - toxB / espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / hlyD 1..136590 136590


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T281179 WP_000421248.1 NZ_CP124743:73386-73661 [Escherichia coli O157:H7 str. EDL933]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT281179 WP_001178089.1 NZ_CP124743:73102-73386 [Escherichia coli O157:H7 str. EDL933]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References