281178

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 28589..29148 Replicon plasmid unnamed3
Accession NZ_CP124743
Organism Escherichia coli O157:H7 str. EDL933

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag QI555_RS28550 Protein ID WP_000421248.1
Coordinates 28873..29148 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QI555_RS28545 Protein ID WP_001178089.1
Coordinates 28589..28873 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QI555_RS28505 (23780) 23780..24340 + 561 WP_000840472.1 fertility inhibition protein FinO -
QI555_RS28510 (24473) 24473..24685 + 213 WP_001302189.1 ANR family transcriptional regulator -
QI555_RS28515 (24930) 24930..25391 + 462 WP_001233853.1 thermonuclease family protein -
QI555_RS28520 (25437) 25437..25646 + 210 WP_001302200.1 hemolysin expression modulator Hha -
QI555_RS28525 (25684) 25684..26022 + 339 WP_000766796.1 hypothetical protein -
QI555_RS28530 (26262) 26262..26516 + 255 WP_000083831.1 replication regulatory protein RepA -
QI555_RS28535 (26752) 26752..26826 + 75 WP_001370046.1 RepA leader peptide Tap -
QI555_RS28540 (26819) 26819..27676 + 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
QI555_RS28545 (28589) 28589..28873 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QI555_RS28550 (28873) 28873..29148 + 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QI555_RS28555 (29243) 29243..29449 + 207 WP_001105064.1 hypothetical protein -
QI555_RS28560 (29549) 29549..29764 - 216 Protein_35 transposase -
QI555_RS28565 (29808) 29808..30374 - 567 Protein_36 IS3-like element IS600 family transposase -
QI555_RS28570 (30374) 30374..30790 - 417 Protein_37 IS91 family transposase -
QI555_RS28575 (30790) 30790..30975 - 186 WP_001302179.1 hypothetical protein -
QI555_RS28580 (31152) 31152..33362 + 2211 WP_000592771.1 catalase/peroxidase KatP -
QI555_RS28585 (33406) 33406..33795 + 390 WP_001172748.1 cytochrome b562 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - toxB / espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / hlyD 1..136590 136590


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T281178 WP_000421248.1 NZ_CP124743:28873-29148 [Escherichia coli O157:H7 str. EDL933]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT281178 WP_001178089.1 NZ_CP124743:28589-28873 [Escherichia coli O157:H7 str. EDL933]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References