Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 24201..24679 Replicon plasmid unnamed2
Accession NZ_CP124741
Organism Escherichia coli O157:H7 str. EDL933

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag QI555_RS25670 Protein ID WP_001303876.1
Coordinates 24201..24488 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag QI555_RS25675 Protein ID WP_000536233.1
Coordinates 24488..24679 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QI555_RS25635 (QI555_25640) 19350..21821 - 2472 WP_000034474.1 exonuclease -
QI555_RS25640 (QI555_25645) 21915..22106 - 192 WP_001098307.1 DUF1482 family protein -
QI555_RS25645 (QI555_25650) 22103..22291 - 189 WP_000413705.1 cell division inhibition protein DicB -
QI555_RS25650 (QI555_25655) 22865..23050 + 186 WP_001133046.1 hypothetical protein -
QI555_RS25655 (QI555_25660) 23237..23626 - 390 WP_000394511.1 hypothetical protein -
QI555_RS25660 (QI555_25665) 23638..23766 - 129 WP_000344963.1 protein YdfB -
QI555_RS25665 (QI555_25670) 23768..23923 - 156 WP_000379575.1 DUF1391 family protein -
QI555_RS25670 (QI555_25675) 24201..24488 - 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QI555_RS25675 (QI555_25680) 24488..24679 - 192 WP_000536233.1 hypothetical protein Antitoxin
QI555_RS25680 (QI555_25685) 24707..25108 - 402 WP_000986592.1 helix-turn-helix domain-containing protein -
QI555_RS25685 (QI555_25690) 25217..25489 + 273 WP_000887453.1 YdaS family helix-turn-helix protein -
QI555_RS25690 (QI555_25695) 25473..25898 + 426 WP_000693855.1 toxin YdaT family protein -
QI555_RS25695 (QI555_25700) 26105..26560 - 456 WP_000273724.1 hypothetical protein -
QI555_RS25700 (QI555_25705) 26639..27730 + 1092 WP_001205823.1 hypothetical protein -
QI555_RS25705 (QI555_25710) 27737..28483 + 747 WP_000788751.1 ATP-binding protein -
QI555_RS25710 (QI555_25715) 28505..29275 + 771 WP_000450992.1 DUF1627 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ompA / espFu/tccP / wza / stx2A / stx2B / iroB / msbA / nueA 1..286775 286775


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T281171 WP_001303876.1 NZ_CP124741:c24488-24201 [Escherichia coli O157:H7 str. EDL933]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT281171 WP_000536233.1 NZ_CP124741:c24679-24488 [Escherichia coli O157:H7 str. EDL933]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References