Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | paaR-paaA-parE/- |
Location | 5124501..5124972 | Replicon | chromosome |
Accession | NZ_CP124740 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
Locus tag | QI555_RS25385 | Protein ID | WP_001303511.1 |
Coordinates | 5124501..5124779 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | paaA | Uniprot ID | Q8XAD5 |
Locus tag | QI555_RS25390 | Protein ID | WP_001302048.1 |
Coordinates | 5124781..5124972 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI555_RS25355 (5119726) | 5119726..5119977 | - | 252 | WP_000005552.1 | excisionase family protein | - |
QI555_RS25360 (5120050) | 5120050..5122521 | - | 2472 | WP_000048458.1 | exonuclease | - |
QI555_RS25365 (5122614) | 5122614..5122805 | - | 192 | WP_001090200.1 | DUF1482 family protein | - |
QI555_RS25370 (5122802) | 5122802..5122990 | - | 189 | WP_000449192.1 | cell division inhibition protein DicB | - |
QI555_RS25375 (5123559) | 5123559..5123777 | - | 219 | WP_001171930.1 | protein YdfC | - |
QI555_RS25380 (5123849) | 5123849..5124148 | - | 300 | WP_001240334.1 | hypothetical protein | - |
QI555_RS25385 (5124501) | 5124501..5124779 | - | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QI555_RS25390 (5124781) | 5124781..5124972 | - | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
QI555_RS25395 (5124993) | 5124993..5125364 | - | 372 | WP_001169686.1 | hypothetical protein | - |
QI555_RS25400 (5125462) | 5125462..5125764 | + | 303 | WP_000172738.1 | transcriptional regulator | - |
QI555_RS25405 (5125761) | 5125761..5126186 | + | 426 | WP_000693943.1 | toxin YdaT family protein | - |
QI555_RS25410 (5126209) | 5126209..5127171 | + | 963 | WP_000095669.1 | helix-turn-helix domain-containing protein | - |
QI555_RS25415 (5127178) | 5127178..5127918 | + | 741 | WP_000788938.1 | ATP-binding protein | - |
QI555_RS25420 (5127944) | 5127944..5128713 | + | 770 | Protein_4963 | DUF1627 domain-containing protein | - |
QI555_RS25425 (5128729) | 5128729..5129124 | + | 396 | WP_001118159.1 | DUF977 family protein | - |
QI555_RS25430 (5129181) | 5129181..5129765 | + | 585 | WP_000206793.1 | DUF551 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5109621..5138767 | 29146 | |
- | inside | Prophage | - | - | 5116214..5138767 | 22553 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T281170 WP_001303511.1 NZ_CP124740:c5124779-5124501 [Escherichia coli O157:H7 str. EDL933]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|