Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3746983..3747566 | Replicon | chromosome |
Accession | NZ_CP124740 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | QI555_RS18455 | Protein ID | WP_000254738.1 |
Coordinates | 3747231..3747566 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QI555_RS18450 | Protein ID | WP_000581937.1 |
Coordinates | 3746983..3747231 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI555_RS18440 (3743322) | 3743322..3744623 | + | 1302 | WP_000046824.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QI555_RS18445 (3744671) | 3744671..3746905 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QI555_RS18450 (3746983) | 3746983..3747231 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QI555_RS18455 (3747231) | 3747231..3747566 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
QI555_RS18460 (3747637) | 3747637..3748428 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QI555_RS18465 (3748656) | 3748656..3750293 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QI555_RS18470 (3750381) | 3750381..3751679 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T281165 WP_000254738.1 NZ_CP124740:3747231-3747566 [Escherichia coli O157:H7 str. EDL933]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|