Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3601502..3602156 | Replicon | chromosome |
| Accession | NZ_CP124740 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | QI555_RS17790 | Protein ID | WP_000244781.1 |
| Coordinates | 3601749..3602156 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QI555_RS17785 | Protein ID | WP_000354046.1 |
| Coordinates | 3601502..3601768 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QI555_RS17765 (3597590) | 3597590..3599023 | - | 1434 | WP_001310226.1 | 6-phospho-beta-glucosidase BglA | - |
| QI555_RS17770 (3599068) | 3599068..3599379 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| QI555_RS17775 (3599543) | 3599543..3600202 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QI555_RS17780 (3600279) | 3600279..3601259 | - | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
| QI555_RS17785 (3601502) | 3601502..3601768 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QI555_RS17790 (3601749) | 3601749..3602156 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| QI555_RS17795 (3602196) | 3602196..3602717 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QI555_RS17800 (3602829) | 3602829..3603725 | + | 897 | WP_000806640.1 | site-specific tyrosine recombinase XerD | - |
| QI555_RS17805 (3603750) | 3603750..3604460 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QI555_RS17810 (3604466) | 3604466..3606199 | + | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T281164 WP_000244781.1 NZ_CP124740:3601749-3602156 [Escherichia coli O157:H7 str. EDL933]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|