Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 3063071..3063871 | Replicon | chromosome |
Accession | NZ_CP124740 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | Q8XED1 |
Locus tag | QI555_RS15040 | Protein ID | WP_000342450.1 |
Coordinates | 3063344..3063871 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | QI555_RS15035 | Protein ID | WP_001277108.1 |
Coordinates | 3063071..3063337 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI555_RS15015 (3058729) | 3058729..3059397 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
QI555_RS15020 (3059390) | 3059390..3060448 | + | 1059 | WP_001042018.1 | permease-like cell division protein FtsX | - |
QI555_RS15025 (3060693) | 3060693..3061547 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QI555_RS15030 (3061818) | 3061818..3062921 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QI555_RS15035 (3063071) | 3063071..3063337 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QI555_RS15040 (3063344) | 3063344..3063871 | + | 528 | WP_000342450.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QI555_RS15045 (3063868) | 3063868..3064251 | - | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QI555_RS15050 (3064675) | 3064675..3065784 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QI555_RS15055 (3065832) | 3065832..3066758 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QI555_RS15060 (3066755) | 3066755..3068032 | + | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
QI555_RS15065 (3068029) | 3068029..3068796 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19678.61 Da Isoelectric Point: 6.9489
>T281160 WP_000342450.1 NZ_CP124740:3063344-3063871 [Escherichia coli O157:H7 str. EDL933]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMNVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMNVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|