Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 2114959..2115554 | Replicon | chromosome |
Accession | NZ_CP124740 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QI555_RS10555 | Protein ID | WP_000239579.1 |
Coordinates | 2114959..2115309 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | Q8XCF3 |
Locus tag | QI555_RS10560 | Protein ID | WP_001223210.1 |
Coordinates | 2115303..2115554 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI555_RS10535 (2110405) | 2110405..2111427 | - | 1023 | WP_001301928.1 | ABC transporter permease | - |
QI555_RS10540 (2111441) | 2111441..2112943 | - | 1503 | WP_000205806.1 | sugar ABC transporter ATP-binding protein | - |
QI555_RS10545 (2113083) | 2113083..2114039 | - | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QI555_RS10550 (2114349) | 2114349..2114879 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QI555_RS10555 (2114959) | 2114959..2115309 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QI555_RS10560 (2115303) | 2115303..2115554 | - | 252 | WP_001223210.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QI555_RS10565 (2115766) | 2115766..2116107 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QI555_RS10570 (2116110) | 2116110..2119889 | - | 3780 | WP_000060930.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T281157 WP_000239579.1 NZ_CP124740:c2115309-2114959 [Escherichia coli O157:H7 str. EDL933]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|