Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 248733..249371 | Replicon | chromosome |
| Accession | NZ_CP124740 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QI555_RS01310 | Protein ID | WP_000813794.1 |
| Coordinates | 248733..248909 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QI555_RS01315 | Protein ID | WP_001270286.1 |
| Coordinates | 248955..249371 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QI555_RS01290 (244355) | 244355..245566 | - | 1212 | WP_071525382.1 | BenE family transporter YdcO | - |
| QI555_RS01295 (245619) | 245619..246155 | + | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
| QI555_RS01300 (246228) | 246228..248189 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QI555_RS01305 (248281) | 248281..248511 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| QI555_RS01310 (248733) | 248733..248909 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QI555_RS01315 (248955) | 248955..249371 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QI555_RS01320 (249450) | 249450..250856 | + | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
| QI555_RS01325 (251101) | 251101..252246 | + | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
| QI555_RS01330 (252264) | 252264..253277 | + | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
| QI555_RS01335 (253278) | 253278..254219 | + | 942 | WP_001251320.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T281150 WP_000813794.1 NZ_CP124740:248733-248909 [Escherichia coli O157:H7 str. EDL933]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT281150 WP_001270286.1 NZ_CP124740:248955-249371 [Escherichia coli O157:H7 str. EDL933]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|