Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 2668318..2668804 | Replicon | chromosome |
| Accession | NZ_CP124733 | ||
| Organism | Agrobacterium larrymoorei strain CFBP5477 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | - |
| Locus tag | CFBP5477_RS13085 | Protein ID | WP_137392827.1 |
| Coordinates | 2668535..2668804 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | - |
| Locus tag | CFBP5477_RS13080 | Protein ID | WP_137392826.1 |
| Coordinates | 2668318..2668551 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5477_RS13050 (CFBP5477_013050) | 2663446..2663892 | + | 447 | WP_137392821.1 | DoxX family protein | - |
| CFBP5477_RS13055 (CFBP5477_013055) | 2663944..2664354 | - | 411 | WP_137392822.1 | GFA family protein | - |
| CFBP5477_RS13060 (CFBP5477_013060) | 2664400..2665098 | - | 699 | WP_027673885.1 | ATP phosphoribosyltransferase | - |
| CFBP5477_RS13065 (CFBP5477_013065) | 2665095..2666216 | - | 1122 | WP_137392823.1 | ATP phosphoribosyltransferase regulatory subunit | - |
| CFBP5477_RS13070 (CFBP5477_013070) | 2666233..2666601 | - | 369 | WP_137392824.1 | VOC family protein | - |
| CFBP5477_RS13075 (CFBP5477_013075) | 2666608..2668164 | - | 1557 | WP_137392825.1 | histidine--tRNA ligase | - |
| CFBP5477_RS13080 (CFBP5477_013080) | 2668318..2668551 | + | 234 | WP_137392826.1 | DUF6290 family protein | Antitoxin |
| CFBP5477_RS13085 (CFBP5477_013085) | 2668535..2668804 | + | 270 | WP_137392827.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CFBP5477_RS13090 (CFBP5477_013090) | 2668808..2669572 | + | 765 | WP_137392828.1 | hypothetical protein | - |
| CFBP5477_RS13095 (CFBP5477_013095) | 2669816..2669974 | + | 159 | WP_170980118.1 | hypothetical protein | - |
| CFBP5477_RS13100 (CFBP5477_013100) | 2670026..2670391 | + | 366 | WP_137392829.1 | DUF305 domain-containing protein | - |
| CFBP5477_RS13105 (CFBP5477_013105) | 2670438..2671352 | - | 915 | WP_137392830.1 | LysR substrate-binding domain-containing protein | - |
| CFBP5477_RS13110 (CFBP5477_013110) | 2671434..2672471 | + | 1038 | WP_137392831.1 | putative sulfate exporter family transporter | - |
| CFBP5477_RS13115 (CFBP5477_013115) | 2672468..2672911 | - | 444 | WP_234882817.1 | hypothetical protein | - |
| CFBP5477_RS13120 (CFBP5477_013120) | 2672908..2673537 | - | 630 | WP_137392832.1 | DNA-3-methyladenine glycosylase I | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10578.17 Da Isoelectric Point: 10.3379
>T281145 WP_137392827.1 NZ_CP124733:2668535-2668804 [Agrobacterium larrymoorei]
MIWEIEFRESARKQLKKLGRQDATRIIAFLSDRISADTNPRRTGQALQGSELGNFWRYRVGDYRIICDIQDQKLVIIVIE
IGHRREVYR
MIWEIEFRESARKQLKKLGRQDATRIIAFLSDRISADTNPRRTGQALQGSELGNFWRYRVGDYRIICDIQDQKLVIIVIE
IGHRREVYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|