Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 2445937..2446475 | Replicon | chromosome |
Accession | NZ_CP124733 | ||
Organism | Agrobacterium larrymoorei strain CFBP5477 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | CFBP5477_RS11965 | Protein ID | WP_137392674.1 |
Coordinates | 2446182..2446475 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | CFBP5477_RS11960 | Protein ID | WP_137392673.1 |
Coordinates | 2445937..2446185 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5477_RS11925 (CFBP5477_011925) | 2441434..2441922 | - | 489 | WP_137392669.1 | DUF1579 domain-containing protein | - |
CFBP5477_RS11930 (CFBP5477_011930) | 2441936..2442664 | - | 729 | WP_137392670.1 | thioredoxin family protein | - |
CFBP5477_RS11935 (CFBP5477_011935) | 2442784..2443230 | + | 447 | WP_137392671.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
CFBP5477_RS11940 (CFBP5477_011940) | 2443461..2444225 | - | 765 | WP_170980104.1 | RES family NAD+ phosphorylase | - |
CFBP5477_RS11945 (CFBP5477_011945) | 2444185..2444568 | - | 384 | WP_027675631.1 | MbcA/ParS/Xre antitoxin family protein | - |
CFBP5477_RS11950 (CFBP5477_011950) | 2444692..2445117 | - | 426 | WP_027675632.1 | organic hydroperoxide resistance protein | - |
CFBP5477_RS11955 (CFBP5477_011955) | 2445312..2445773 | + | 462 | WP_137392672.1 | MarR family transcriptional regulator | - |
CFBP5477_RS11960 (CFBP5477_011960) | 2445937..2446185 | + | 249 | WP_137392673.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
CFBP5477_RS11965 (CFBP5477_011965) | 2446182..2446475 | + | 294 | WP_137392674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP5477_RS11970 (CFBP5477_011970) | 2446533..2446868 | - | 336 | WP_197736736.1 | NINE protein | - |
CFBP5477_RS11975 (CFBP5477_011975) | 2447002..2447736 | - | 735 | WP_027675637.1 | L,D-transpeptidase | - |
CFBP5477_RS11980 (CFBP5477_011980) | 2447937..2448821 | - | 885 | WP_137392675.1 | L,D-transpeptidase | - |
CFBP5477_RS11985 (CFBP5477_011985) | 2448935..2449876 | - | 942 | WP_137392676.1 | prolyl oligopeptidase family serine peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11084.53 Da Isoelectric Point: 6.4764
>T281144 WP_137392674.1 NZ_CP124733:2446182-2446475 [Agrobacterium larrymoorei]
MKALALSPAAEADLDYIWEHSATNWGLDQADRYTDEIRDACLNLAAGVRHGRPVDVRSGYLKFATGTHMIYFRDQGDRLD
IVRILHQRQDVIFNLPK
MKALALSPAAEADLDYIWEHSATNWGLDQADRYTDEIRDACLNLAAGVRHGRPVDVRSGYLKFATGTHMIYFRDQGDRLD
IVRILHQRQDVIFNLPK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|