Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 2358983..2359588 Replicon chromosome
Accession NZ_CP124733
Organism Agrobacterium larrymoorei strain CFBP5477

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag CFBP5477_RS11450 Protein ID WP_027676894.1
Coordinates 2358983..2359210 (-) Length 76 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag CFBP5477_RS11455 Protein ID WP_137392599.1
Coordinates 2359313..2359588 (-) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFBP5477_RS11420 (CFBP5477_011420) 2354176..2354820 - 645 WP_137392594.1 suppressor of fused domain protein -
CFBP5477_RS11425 (CFBP5477_011425) 2355100..2355513 + 414 WP_137392595.1 hypothetical protein -
CFBP5477_RS11430 (CFBP5477_011430) 2355514..2355783 - 270 WP_137392596.1 hypothetical protein -
CFBP5477_RS11435 (CFBP5477_011435) 2355865..2356449 + 585 WP_137392597.1 YcxB family protein -
CFBP5477_RS11440 (CFBP5477_011440) 2356524..2357987 + 1464 WP_170980101.1 YdiU family protein -
CFBP5477_RS11445 (CFBP5477_011445) 2358166..2358978 + 813 WP_137392598.1 class D beta-lactamase -
CFBP5477_RS11450 (CFBP5477_011450) 2358983..2359210 - 228 WP_027676894.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
CFBP5477_RS11455 (CFBP5477_011455) 2359313..2359588 - 276 WP_137392599.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
CFBP5477_RS11460 (CFBP5477_011460) 2359734..2362253 + 2520 WP_170980102.1 heavy metal translocating P-type ATPase -
CFBP5477_RS11465 (CFBP5477_011465) 2362250..2362669 + 420 WP_137392600.1 Cu(I)-responsive transcriptional regulator -
CFBP5477_RS11470 (CFBP5477_011470) 2362688..2362855 + 168 WP_137392601.1 heavy-metal-associated domain-containing protein -
CFBP5477_RS11475 (CFBP5477_011475) 2362895..2363326 - 432 WP_137392602.1 Lrp/AsnC family transcriptional regulator -
CFBP5477_RS11480 (CFBP5477_011480) 2363446..2364546 + 1101 WP_137392603.1 saccharopine dehydrogenase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2355514..2370998 15484


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(10-75)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-84)


Sequences

Toxin        


Download         Length: 76 a.a.        Molecular weight: 8736.95 Da        Isoelectric Point: 4.9491

>T281142 WP_027676894.1 NZ_CP124733:c2359210-2358983 [Agrobacterium larrymoorei]
MNPVVTTWWLKEVMLLSIANDAPLPLNFRDHELTGDWRDHRECHIGGDFLLIYTLDDAQNLIVFTRAGTHSELFR

Download         Length: 228 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10176.68 Da        Isoelectric Point: 5.2187

>AT281142 WP_137392599.1 NZ_CP124733:c2359588-2359313 [Agrobacterium larrymoorei]
MTANAYVRARIDQEIKDDATAVLDSLGLTVSDVMRMMLTRIAREKALPIELTRPNAETLAALEEAKEIARAKRERFRSAE
ELFDALNGGKQ

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References