Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2161705..2162336 | Replicon | chromosome |
| Accession | NZ_CP124733 | ||
| Organism | Agrobacterium larrymoorei strain CFBP5477 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A4D7DKT4 |
| Locus tag | CFBP5477_RS10465 | Protein ID | WP_027675859.1 |
| Coordinates | 2161705..2162103 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | CFBP5477_RS10470 | Protein ID | WP_137393484.1 |
| Coordinates | 2162103..2162336 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5477_RS10450 (CFBP5477_010450) | 2158794..2159735 | + | 942 | WP_137393481.1 | peptidylprolyl isomerase | - |
| CFBP5477_RS10455 (CFBP5477_010455) | 2159842..2160858 | + | 1017 | WP_137393482.1 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | - |
| CFBP5477_RS10460 (CFBP5477_010460) | 2160858..2161688 | + | 831 | WP_137393483.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| CFBP5477_RS10465 (CFBP5477_010465) | 2161705..2162103 | - | 399 | WP_027675859.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CFBP5477_RS10470 (CFBP5477_010470) | 2162103..2162336 | - | 234 | WP_137393484.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| CFBP5477_RS10475 (CFBP5477_010475) | 2162413..2163081 | - | 669 | WP_137393485.1 | guanylate kinase | - |
| CFBP5477_RS10480 (CFBP5477_010480) | 2163087..2163974 | - | 888 | WP_137393486.1 | YicC/YloC family endoribonuclease | - |
| CFBP5477_RS10485 (CFBP5477_010485) | 2164032..2165249 | - | 1218 | WP_027675864.1 | endolytic transglycosylase MltG | - |
| CFBP5477_RS10490 (CFBP5477_010490) | 2165523..2166785 | - | 1263 | WP_027675865.1 | beta-ketoacyl-ACP synthase II | - |
| CFBP5477_RS10495 (CFBP5477_010495) | 2166925..2167161 | - | 237 | WP_027675866.1 | acyl carrier protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14862.17 Da Isoelectric Point: 6.8525
>T281140 WP_027675859.1 NZ_CP124733:c2162103-2161705 [Agrobacterium larrymoorei]
MLTYMLDTNICIYVMKTYPPELREKFNALAEQLCISSITLGELYYGAEKSARRTDNIHAIDNFVARLEVLPFADKAAAHY
GQIRAELTKAGTPCGVHDMQIGGHARSEGLIVVTNNMREFVRMPGLRVENWV
MLTYMLDTNICIYVMKTYPPELREKFNALAEQLCISSITLGELYYGAEKSARRTDNIHAIDNFVARLEVLPFADKAAAHY
GQIRAELTKAGTPCGVHDMQIGGHARSEGLIVVTNNMREFVRMPGLRVENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|