Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 1372528..1373072 | Replicon | chromosome |
| Accession | NZ_CP124733 | ||
| Organism | Agrobacterium larrymoorei strain CFBP5477 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | CFBP5477_RS06480 | Protein ID | WP_137394155.1 |
| Coordinates | 1372749..1373072 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | CFBP5477_RS06475 | Protein ID | WP_137394154.1 |
| Coordinates | 1372528..1372752 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5477_RS06455 (CFBP5477_006455) | 1367632..1369398 | + | 1767 | WP_137394150.1 | penicillin-binding protein 2 | - |
| CFBP5477_RS06460 (CFBP5477_006460) | 1369392..1370603 | - | 1212 | WP_137394151.1 | MFS transporter | - |
| CFBP5477_RS06465 (CFBP5477_006465) | 1370675..1371583 | - | 909 | WP_137394152.1 | LysR family transcriptional regulator | - |
| CFBP5477_RS06470 (CFBP5477_006470) | 1371681..1372430 | + | 750 | WP_137394153.1 | sulfite exporter TauE/SafE family protein | - |
| CFBP5477_RS06475 (CFBP5477_006475) | 1372528..1372752 | + | 225 | WP_137394154.1 | antitoxin MazE family protein | Antitoxin |
| CFBP5477_RS06480 (CFBP5477_006480) | 1372749..1373072 | + | 324 | WP_137394155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| CFBP5477_RS06485 (CFBP5477_006485) | 1373108..1373401 | - | 294 | WP_027677142.1 | hypothetical protein | - |
| CFBP5477_RS06490 (CFBP5477_006490) | 1373962..1374333 | + | 372 | WP_003507760.1 | 30S ribosomal protein S12 | - |
| CFBP5477_RS06495 (CFBP5477_006495) | 1374411..1374881 | + | 471 | WP_027677141.1 | 30S ribosomal protein S7 | - |
| CFBP5477_RS06500 (CFBP5477_006500) | 1374909..1377008 | + | 2100 | WP_027677140.1 | elongation factor G | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11549.46 Da Isoelectric Point: 9.9929
>T281139 WP_137394155.1 NZ_CP124733:1372749-1373072 [Agrobacterium larrymoorei]
VRRGDLVTVSVSGDFGKPRPALVIQSDYFSETATVTVLLVSGTLVDAPFIRLTIQPSSRNGLVKPSQVMIDKPMTVLREK
VGQSFGRLEDDVMLSVTRSLAVFVGLA
VRRGDLVTVSVSGDFGKPRPALVIQSDYFSETATVTVLLVSGTLVDAPFIRLTIQPSSRNGLVKPSQVMIDKPMTVLREK
VGQSFGRLEDDVMLSVTRSLAVFVGLA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|