Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1337864..1338383 | Replicon | chromosome |
Accession | NZ_CP124733 | ||
Organism | Agrobacterium larrymoorei strain CFBP5477 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | CFBP5477_RS06295 | Protein ID | WP_137394136.1 |
Coordinates | 1338102..1338383 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CFBP5477_RS06290 | Protein ID | WP_137394135.1 |
Coordinates | 1337864..1338112 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5477_RS06275 (CFBP5477_006275) | 1333866..1336916 | - | 3051 | WP_137394133.1 | excinuclease ABC subunit UvrB | - |
CFBP5477_RS06280 (CFBP5477_006280) | 1336962..1337450 | - | 489 | WP_170980186.1 | hypothetical protein | - |
CFBP5477_RS06285 (CFBP5477_006285) | 1337383..1337736 | + | 354 | WP_027676067.1 | DMT family protein | - |
CFBP5477_RS06290 (CFBP5477_006290) | 1337864..1338112 | + | 249 | WP_137394135.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
CFBP5477_RS06295 (CFBP5477_006295) | 1338102..1338383 | + | 282 | WP_137394136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP5477_RS06300 (CFBP5477_006300) | 1338388..1338849 | + | 462 | WP_234882881.1 | GNAT family N-acetyltransferase | - |
CFBP5477_RS06305 (CFBP5477_006305) | 1338989..1339414 | - | 426 | WP_137394206.1 | MarR family transcriptional regulator | - |
CFBP5477_RS06310 (CFBP5477_006310) | 1339469..1339864 | - | 396 | WP_137394137.1 | multidrug efflux SMR transporter | - |
CFBP5477_RS06315 (CFBP5477_006315) | 1339888..1340223 | - | 336 | WP_234882883.1 | multidrug efflux SMR transporter | - |
CFBP5477_RS06320 (CFBP5477_006320) | 1340482..1341924 | - | 1443 | WP_137394138.1 | PepSY domain-containing protein | - |
CFBP5477_RS06325 (CFBP5477_006325) | 1342010..1342414 | - | 405 | WP_137394139.1 | DUF2946 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1331009..1340208 | 9199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10805.59 Da Isoelectric Point: 10.6956
>T281138 WP_137394136.1 NZ_CP124733:1338102-1338383 [Agrobacterium larrymoorei]
MSYELGFVDAALKEWRKLDSNTQEQFKKKLAERLVNPRVPAAKLSGHSDRYKIKLRGAGYRLVYEVRDKEVLVLVVAVGR
RDRDQVYKLAAKR
MSYELGFVDAALKEWRKLDSNTQEQFKKKLAERLVNPRVPAAKLSGHSDRYKIKLRGAGYRLVYEVRDKEVLVLVVAVGR
RDRDQVYKLAAKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|