Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1021469..1022083 | Replicon | chromosome |
Accession | NZ_CP124733 | ||
Organism | Agrobacterium larrymoorei strain CFBP5477 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | CFBP5477_RS04835 | Protein ID | WP_137393917.1 |
Coordinates | 1021832..1022083 (-) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CFBP5477_RS04830 | Protein ID | WP_137393916.1 |
Coordinates | 1021469..1021822 (-) | Length | 118 a.a. |
Genomic Context
Location: 1017782..1018192 (411 bp)
Type: Others
Protein ID: WP_137394062.1
Type: Others
Protein ID: WP_137394062.1
Location: 1019482..1020051 (570 bp)
Type: Others
Protein ID: WP_137393914.1
Type: Others
Protein ID: WP_137393914.1
Location: 1020149..1021462 (1314 bp)
Type: Others
Protein ID: WP_137393915.1
Type: Others
Protein ID: WP_137393915.1
Location: 1016652..1017617 (966 bp)
Type: Others
Protein ID: WP_027674214.1
Type: Others
Protein ID: WP_027674214.1
Location: 1018202..1019194 (993 bp)
Type: Others
Protein ID: WP_137393913.1
Type: Others
Protein ID: WP_137393913.1
Location: 1021469..1021822 (354 bp)
Type: Antitoxin
Protein ID: WP_137393916.1
Type: Antitoxin
Protein ID: WP_137393916.1
Location: 1021832..1022083 (252 bp)
Type: Toxin
Protein ID: WP_137393917.1
Type: Toxin
Protein ID: WP_137393917.1
Location: 1022132..1022569 (438 bp)
Type: Others
Protein ID: WP_137393918.1
Type: Others
Protein ID: WP_137393918.1
Location: 1022573..1024654 (2082 bp)
Type: Others
Protein ID: WP_137393919.1
Type: Others
Protein ID: WP_137393919.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5477_RS04805 (CFBP5477_004805) | 1016652..1017617 | - | 966 | WP_027674214.1 | metallophosphoesterase | - |
CFBP5477_RS04810 (CFBP5477_004810) | 1017782..1018192 | + | 411 | WP_137394062.1 | NUDIX domain-containing protein | - |
CFBP5477_RS04815 (CFBP5477_004815) | 1018202..1019194 | - | 993 | WP_137393913.1 | glutathione S-transferase family protein | - |
CFBP5477_RS04820 (CFBP5477_004820) | 1019482..1020051 | + | 570 | WP_137393914.1 | N-acetyltransferase | - |
CFBP5477_RS04825 (CFBP5477_004825) | 1020149..1021462 | + | 1314 | WP_137393915.1 | MFS transporter | - |
CFBP5477_RS04830 (CFBP5477_004830) | 1021469..1021822 | - | 354 | WP_137393916.1 | helix-turn-helix transcriptional regulator | Antitoxin |
CFBP5477_RS04835 (CFBP5477_004835) | 1021832..1022083 | - | 252 | WP_137393917.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP5477_RS04840 (CFBP5477_004840) | 1022132..1022569 | - | 438 | WP_137393918.1 | GNAT family N-acetyltransferase | - |
CFBP5477_RS04845 (CFBP5477_004845) | 1022573..1024654 | - | 2082 | WP_137393919.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9307.84 Da Isoelectric Point: 10.4524
>T281137 WP_137393917.1 NZ_CP124733:c1022083-1021832 [Agrobacterium larrymoorei]
MKKIAYSKSSIKVLRRLPANEAKRIISKIEQYASDPDSLANNVKALVGSPYIRLRVGDWRVIMDDNGNILEIVNIGPRGG
IYH
MKKIAYSKSSIKVLRRLPANEAKRIISKIEQYASDPDSLANNVKALVGSPYIRLRVGDWRVIMDDNGNILEIVNIGPRGG
IYH
Download Length: 252 bp
Antitoxin
Download Length: 118 a.a. Molecular weight: 12398.12 Da Isoelectric Point: 4.2439
>AT281137 WP_137393916.1 NZ_CP124733:c1021822-1021469 [Agrobacterium larrymoorei]
MQTITTPNGETLVVLPLAEYESLIDQADIAAADKVKADIAAGRDELVPSEIVERLISGENPVKVWRSHRGLSAKALAAEA
GISAPYLSEIEGGKKEGSLSVMKKIAEVLDVDLDDLA
MQTITTPNGETLVVLPLAEYESLIDQADIAAADKVKADIAAGRDELVPSEIVERLISGENPVKVWRSHRGLSAKALAAEA
GISAPYLSEIEGGKKEGSLSVMKKIAEVLDVDLDDLA
Download Length: 354 bp