Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 1013995..1014487 | Replicon | chromosome |
| Accession | NZ_CP124733 | ||
| Organism | Agrobacterium larrymoorei strain CFBP5477 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | CFBP5477_RS04790 | Protein ID | WP_137393910.1 |
| Coordinates | 1013995..1014264 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | CFBP5477_RS04795 | Protein ID | WP_137393911.1 |
| Coordinates | 1014245..1014487 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5477_RS04780 (CFBP5477_004780) | 1012006..1012692 | + | 687 | WP_170980174.1 | DUF930 domain-containing protein | - |
| CFBP5477_RS04785 (CFBP5477_004785) | 1012795..1013982 | + | 1188 | WP_137393909.1 | benzoate/H(+) symporter BenE family transporter | - |
| CFBP5477_RS04790 (CFBP5477_004790) | 1013995..1014264 | + | 270 | WP_137393910.1 | BrnT family toxin | Toxin |
| CFBP5477_RS04795 (CFBP5477_004795) | 1014245..1014487 | + | 243 | WP_137393911.1 | CopG family transcriptional regulator | Antitoxin |
| CFBP5477_RS04800 (CFBP5477_004800) | 1014806..1016512 | + | 1707 | WP_137393912.1 | 2-isopropylmalate synthase | - |
| CFBP5477_RS04805 (CFBP5477_004805) | 1016652..1017617 | - | 966 | WP_027674214.1 | metallophosphoesterase | - |
| CFBP5477_RS04810 (CFBP5477_004810) | 1017782..1018192 | + | 411 | WP_137394062.1 | NUDIX domain-containing protein | - |
| CFBP5477_RS04815 (CFBP5477_004815) | 1018202..1019194 | - | 993 | WP_137393913.1 | glutathione S-transferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10682.14 Da Isoelectric Point: 8.0552
>T281136 WP_137393910.1 NZ_CP124733:1013995-1014264 [Agrobacterium larrymoorei]
MEFEFDPAKSASNKDKHGIDFVDAQNLWLDQRRLIAPLVMEGEERYIMIARLHDKIWSTIFTYRGGRVRIISVRRARDKE
RQHYENDQC
MEFEFDPAKSASNKDKHGIDFVDAQNLWLDQRRLIAPLVMEGEERYIMIARLHDKIWSTIFTYRGGRVRIISVRRARDKE
RQHYENDQC
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|