Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 853566..854151 | Replicon | chromosome |
Accession | NZ_CP124733 | ||
Organism | Agrobacterium larrymoorei strain CFBP5477 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | CFBP5477_RS04015 | Protein ID | WP_137393794.1 |
Coordinates | 853864..854151 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CFBP5477_RS04010 | Protein ID | WP_137393793.1 |
Coordinates | 853566..853862 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5477_RS03990 (CFBP5477_003990) | 849657..850964 | - | 1308 | WP_137393790.1 | guanine deaminase | - |
CFBP5477_RS03995 (CFBP5477_003995) | 850961..852208 | - | 1248 | WP_137393791.1 | urate hydroxylase PuuD | - |
CFBP5477_RS04000 (CFBP5477_004000) | 852323..853216 | - | 894 | WP_137393792.1 | transcriptional regulator GcvA | - |
CFBP5477_RS04005 (CFBP5477_004005) | 853321..853551 | + | 231 | WP_027676623.1 | hypothetical protein | - |
CFBP5477_RS04010 (CFBP5477_004010) | 853566..853862 | - | 297 | WP_137393793.1 | putative addiction module antidote protein | Antitoxin |
CFBP5477_RS04015 (CFBP5477_004015) | 853864..854151 | - | 288 | WP_137393794.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP5477_RS04020 (CFBP5477_004020) | 854199..855026 | - | 828 | WP_137393795.1 | xanthine dehydrogenase accessory protein XdhC | - |
CFBP5477_RS04025 (CFBP5477_004025) | 855036..857375 | - | 2340 | WP_170980168.1 | xanthine dehydrogenase molybdopterin binding subunit | - |
CFBP5477_RS04030 (CFBP5477_004030) | 857582..859048 | - | 1467 | WP_137393796.1 | xanthine dehydrogenase small subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11066.88 Da Isoelectric Point: 10.6020
>T281135 WP_137393794.1 NZ_CP124733:c854151-853864 [Agrobacterium larrymoorei]
MIRIRKTNIFSDWFTSLRDRRAQARIQVRIDRLSLGLLGDVKFFDGIGEMRIDYGPGYRVYFMRRQNEIVILLCGGDKGS
QTRDIERAIKIAAEV
MIRIRKTNIFSDWFTSLRDRRAQARIQVRIDRLSLGLLGDVKFFDGIGEMRIDYGPGYRVYFMRRQNEIVILLCGGDKGS
QTRDIERAIKIAAEV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|