Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
Location | 843739..844335 | Replicon | chromosome |
Accession | NZ_CP124733 | ||
Organism | Agrobacterium larrymoorei strain CFBP5477 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | CFBP5477_RS03970 | Protein ID | WP_282503319.1 |
Coordinates | 844042..844335 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | CFBP5477_RS03965 | Protein ID | WP_137393786.1 |
Coordinates | 843739..843990 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5477_RS03925 (CFBP5477_003925) | 839138..839845 | + | 708 | WP_137393778.1 | DUF1045 domain-containing protein | - |
CFBP5477_RS03930 (CFBP5477_003930) | 839924..840847 | + | 924 | WP_137393779.1 | allantoinase PuuE | - |
CFBP5477_RS03935 (CFBP5477_003935) | 840844..841347 | + | 504 | WP_137393780.1 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | - |
CFBP5477_RS03940 (CFBP5477_003940) | 841413..841706 | + | 294 | WP_137393781.1 | nucleotidyltransferase family protein | - |
CFBP5477_RS03945 (CFBP5477_003945) | 841703..842065 | + | 363 | WP_137393782.1 | DUF86 domain-containing protein | - |
CFBP5477_RS03950 (CFBP5477_003950) | 842082..842582 | + | 501 | WP_137393783.1 | ureidoglycolate lyase | - |
CFBP5477_RS03955 (CFBP5477_003955) | 842579..842935 | + | 357 | WP_137393784.1 | hydroxyisourate hydrolase | - |
CFBP5477_RS03960 (CFBP5477_003960) | 842941..843681 | + | 741 | WP_137393785.1 | metallophosphoesterase family protein | - |
CFBP5477_RS03965 (CFBP5477_003965) | 843739..843990 | + | 252 | WP_137393786.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
CFBP5477_RS03970 (CFBP5477_003970) | 844042..844335 | + | 294 | WP_282503319.1 | Txe/YoeB family addiction module toxin | Toxin |
CFBP5477_RS03975 (CFBP5477_003975) | 844347..845615 | - | 1269 | WP_137393787.1 | D-alanyl-D-alanine carboxypeptidase | - |
CFBP5477_RS03980 (CFBP5477_003980) | 846045..847187 | - | 1143 | WP_170980167.1 | alpha-hydroxy acid oxidase | - |
CFBP5477_RS03985 (CFBP5477_003985) | 847374..849326 | - | 1953 | WP_137393789.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11634.44 Da Isoelectric Point: 9.7522
>T281134 WP_282503319.1 NZ_CP124733:844042-844335 [Agrobacterium larrymoorei]
MPHGEKSSEILLSWTSKGWEDYLYWQQADKKVLVRINELIRDALRHPFEGIGKPEPLRFNLKGLWSRRITQEHRLIYAIR
GEGDRRTLVILQCLYHY
MPHGEKSSEILLSWTSKGWEDYLYWQQADKKVLVRINELIRDALRHPFEGIGKPEPLRFNLKGLWSRRITQEHRLIYAIR
GEGDRRTLVILQCLYHY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|