Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 711741..712405 | Replicon | chromosome |
Accession | NZ_CP124733 | ||
Organism | Agrobacterium larrymoorei strain CFBP5477 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | CFBP5477_RS03290 | Protein ID | WP_137393701.1 |
Coordinates | 711741..712142 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | CFBP5477_RS03295 | Protein ID | WP_137393702.1 |
Coordinates | 712142..712405 (-) | Length | 88 a.a. |
Genomic Context
Location: 707277..708512 (1236 bp)
Type: Others
Protein ID: WP_027675557.1
Type: Others
Protein ID: WP_027675557.1
Location: 708593..709825 (1233 bp)
Type: Others
Protein ID: WP_027675558.1
Type: Others
Protein ID: WP_027675558.1
Location: 710001..710186 (186 bp)
Type: Others
Protein ID: WP_027675559.1
Type: Others
Protein ID: WP_027675559.1
Location: 710263..711720 (1458 bp)
Type: Others
Protein ID: WP_137393700.1
Type: Others
Protein ID: WP_137393700.1
Location: 711741..712142 (402 bp)
Type: Toxin
Protein ID: WP_137393701.1
Type: Toxin
Protein ID: WP_137393701.1
Location: 712142..712405 (264 bp)
Type: Antitoxin
Protein ID: WP_137393702.1
Type: Antitoxin
Protein ID: WP_137393702.1
Location: 712464..717206 (4743 bp)
Type: Others
Protein ID: WP_137393703.1
Type: Others
Protein ID: WP_137393703.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5477_RS03270 (CFBP5477_003270) | 707277..708512 | + | 1236 | WP_027675557.1 | lytic murein transglycosylase | - |
CFBP5477_RS03275 (CFBP5477_003275) | 708593..709825 | + | 1233 | WP_027675558.1 | DUF459 domain-containing protein | - |
CFBP5477_RS03280 (CFBP5477_003280) | 710001..710186 | + | 186 | WP_027675559.1 | hypothetical protein | - |
CFBP5477_RS03285 (CFBP5477_003285) | 710263..711720 | - | 1458 | WP_137393700.1 | glutamate synthase subunit beta | - |
CFBP5477_RS03290 (CFBP5477_003290) | 711741..712142 | - | 402 | WP_137393701.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CFBP5477_RS03295 (CFBP5477_003295) | 712142..712405 | - | 264 | WP_137393702.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
CFBP5477_RS03300 (CFBP5477_003300) | 712464..717206 | - | 4743 | WP_137393703.1 | glutamate synthase large subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14997.14 Da Isoelectric Point: 6.0844
>T281133 WP_137393701.1 NZ_CP124733:c712142-711741 [Agrobacterium larrymoorei]
MRYLLDTNAISHVIDFPTGSVAQRIRTEAVTGTLVTSVIVVAELRYGYTKISSQRLRDAYETFFESLPIENWEAPFDHVY
ADIRDQLTKKGRSIGAMDMLIAAHALATDAVVVTANIKHFSEVPELKVENWLR
MRYLLDTNAISHVIDFPTGSVAQRIRTEAVTGTLVTSVIVVAELRYGYTKISSQRLRDAYETFFESLPIENWEAPFDHVY
ADIRDQLTKKGRSIGAMDMLIAAHALATDAVVVTANIKHFSEVPELKVENWLR
Download Length: 402 bp